@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : HDAC1_HUMAN: (2017-06-15 )
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA

Atome Classification :

(83 SA) .........10........20........30........40........50........60........70...-.....80........90.......-.100.......110.......120.......130.......140.......150.......160....-...170.......180.......190.......200-.-.-..-...210.......220.......230.......240.......250.......260.......270.......280.......290.......300.......310.......320.......330.......340......-.-350.......360.......370.......380.......390.......400.......410.......420.......430.......440.......450.......460.......470.......480
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIK-FLRSIRPDNMSEYSKQMQRFNVGE-DCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYG-E-Y-FP-GTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPS-N-MTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA
2 PsiBlast_PDB 93.30100%-111 - C3 - - 5ICN HDAC1_HUMAN B:[8-376] -------RRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIK-FLRSIRPDNMSEYSKQMQRFNVGE-DCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYG-E-Y-FP-GTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPS-N-MTNQNTNEYLEKIKQRLFENLRMLPHA----------------------------------------------------------------------------------------------------------
6 PsiBlast_PDB 92.0993%-111 - C3 - - 5IWG HDAC2_HUMAN A:[2-368] -------KKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIK-FLRSIRPDNMSEYSKQMQRFNVGE-DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYG-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPS-N-MTNQNTPEYMEKIKQRLFENLRMLP------------------------------------------------------------------------------------------------------------
120 HHSearch 92.05100%-110 - C3 - - 4BKX HDAC1_HUMAN B:[8-376] -------RRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIK-FLRSIRPDNMSEYSKQMQRFNVGE-DCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYG-E-Y-FP-GTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPS-N-MTNQNTNEYLEKIKQRLFENLRMLPHA----------------------------------------------------------------------------------------------------------
1 PsiBlast_PDB 92.05100%-110 - C3 - - 4BKX HDAC1_HUMAN B:[8-376] -------RRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIK-FLRSIRPDNMSEYSKQMQRFNVGE-DCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYG-E-Y-FP-GTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPS-N-MTNQNTNEYLEKIKQRLFENLRMLPHA----------------------------------------------------------------------------------------------------------
26 PsiBlast_CBE 92.0093%-114 - C3 - - 5IX0 HDAC2_HUMAN B:[4-369] --------KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIK-FLRSIRPDNMSEYSKQMQRFNVGE-DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYG-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPS-N-MTNQNTPEYMEKIKQRLFENLRMLP------------------------------------------------------------------------------------------------------------
5 PsiBlast_PDB 91.9293%-110 - C3 - - 5IX0 HDAC2_HUMAN A:[1-369] -----GGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIK-FLRSIRPDNMSEYSKQMQRFNVGE-DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYG-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPS-N-MTNQNTPEYMEKIKQRLFENLRMLP------------------------------------------------------------------------------------------------------------
3 PsiBlast_PDB 91.8593%-112 - C3 - - 4LXZ HDAC2_HUMAN A:[2-368] -------KKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIK-FLRSIRPDNMSEYSKQMQRFNVGE-DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYG-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPS-N-MTNQNTPEYMEKIKQRLFENLRMLP------------------------------------------------------------------------------------------------------------
27 PsiBlast_CBE 91.7793%-116 - C3 - - 5IWG HDAC2_HUMAN C:[3-368] --------KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIK-FLRSIRPDNMSEYSKQMQRFNVGE-DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYG-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPS-N-MTNQNTPEYMEKIKQRLFENLRMLP------------------------------------------------------------------------------------------------------------
124 HHSearch 91.4994%-111 - C3 - - 4LY1 HDAC2_HUMAN A:[2-368] -------KKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIK-FLRSIRPDNMSEYSKQMQRFNVGE-DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYG-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPS-N-MTNQNTPEYMEKIKQRLFENLRMLP------------------------------------------------------------------------------------------------------------
25 PsiBlast_CBE 91.4993%-117 - C3 - - 5IX0 HDAC2_HUMAN C:[4-369] --------KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIK-FLRSIRPDNMSEYSKQMQRFNVGE-DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYG-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPS-N-MTNQNTPEYMEKIKQRLFENLRMLP------------------------------------------------------------------------------------------------------------
4 PsiBlast_PDB 91.2893%-111 - C3 - - 4LY1 HDAC2_HUMAN A:[2-368] -------KKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIK-FLRSIRPDNMSEYSKQMQRFNVGE-DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYG-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPS-N-MTNQNTPEYMEKIKQRLFENLRMLP------------------------------------------------------------------------------------------------------------