@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : HDAC2_HUMAN: (2017-06-15 )
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP

Atome Classification :

(84 SA) .........10........20........30........40........50........60........70....-....80........90.......-.100.......110.......120.......130.......140.......150.......160.....-..170.......180.......190.......200.-.-.-..-..210.......220.......230.......240.......250.......260.......270.......280.......290.......300.......310.......320.......330.......340.......-350........360.......370.......380.......390.......400.......410.......420.......430.......440.......450.......460.......470.......480......
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIK-FLRSIRPDNMSEYSKQMQRFNVG-EDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYG-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPS-N-MTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP
2 PsiBlast_PDB 94.90100%-114 - C2 - - 4LXZ HDAC2_HUMAN A:[1-368] -------GKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIK-FLRSIRPDNMSEYSKQMQRFNVG-EDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYG-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPS-N-MTNQNTPEYMEKIKQRLFENLRMLP-----------------------------------------------------------------------------------------------------------------
5 PsiBlast_PDB 94.44100%-114 - C2 - - 5IWG HDAC2_HUMAN A:[1-368] -------GKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIK-FLRSIRPDNMSEYSKQMQRFNVG-EDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYG-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPS-N-MTNQNTPEYMEKIKQRLFENLRMLP-----------------------------------------------------------------------------------------------------------------
27 PsiBlast_CBE 94.35100%-119 - C2 - - 5IWG HDAC2_HUMAN C:[3-368] ---------KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIK-FLRSIRPDNMSEYSKQMQRFNVG-EDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYG-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPS-N-MTNQNTPEYMEKIKQRLFENLRMLP-----------------------------------------------------------------------------------------------------------------
26 PsiBlast_CBE 94.26100%-116 - C2 - - 5IX0 HDAC2_HUMAN B:[4-369] ---------KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIK-FLRSIRPDNMSEYSKQMQRFNVG-EDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYG-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPS-N-MTNQNTPEYMEKIKQRLFENLRMLP-----------------------------------------------------------------------------------------------------------------
3 PsiBlast_PDB 94.15100%-113 - C2 - - 4LY1 HDAC2_HUMAN A:[1-368] -------GKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIK-FLRSIRPDNMSEYSKQMQRFNVG-EDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYG-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPS-N-MTNQNTPEYMEKIKQRLFENLRMLP-----------------------------------------------------------------------------------------------------------------
4 PsiBlast_PDB 94.10100%-113 - C2 - - 5IX0 HDAC2_HUMAN A:[1-369] ------GGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIK-FLRSIRPDNMSEYSKQMQRFNVG-EDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYG-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPS-N-MTNQNTPEYMEKIKQRLFENLRMLP-----------------------------------------------------------------------------------------------------------------
25 PsiBlast_CBE 94.02100%-119 - C2 - - 5IX0 HDAC2_HUMAN C:[4-369] ---------KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIK-FLRSIRPDNMSEYSKQMQRFNVG-EDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYG-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPS-N-MTNQNTPEYMEKIKQRLFENLRMLP-----------------------------------------------------------------------------------------------------------------
123 HHSearch 93.92100%-114 - C2 - - 4LY1 HDAC2_HUMAN A:[2-368] --------KKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIK-FLRSIRPDNMSEYSKQMQRFNVG-EDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYG-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPS-N-MTNQNTPEYMEKIKQRLFENLRMLP-----------------------------------------------------------------------------------------------------------------
28 PsiBlast_CBE 93.82100%-114 - C2 - - 5IWG HDAC2_HUMAN B:[3-368] ---------KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIK-FLRSIRPDNMSEYSKQMQRFNVG-EDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYG-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPS-N-MTNQNTPEYMEKIKQRLFENLRMLP-----------------------------------------------------------------------------------------------------------------
6 PsiBlast_PDB 93.3399%-114 - C2 - - 3MAX HDAC2_HUMAN A:[1-367] -------AKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIK-FLRSIRPDNMSEYSKQMQRFNVG-EDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYG-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPS-N-MTNQNTPEYMEKIKQRLFENLRML------------------------------------------------------------------------------------------------------------------
22 PsiBlast_CBE 93.15100%-114 - C2 - - 4LY1 HDAC2_HUMAN B:[2-368] --------KKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIK-FLRSIRPDNMSEYSKQMQRFNVG-EDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYG-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPS-N-MTNQNTPEYMEKIKQRLFENLRMLP-----------------------------------------------------------------------------------------------------------------