@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : HDAC3_HUMAN: (2017-06-15 )
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI

Atome Classification :

(118 SA) .........10........20........30........40........50........60........70........80..-......90.-.......100.......110.......120.......130.......140.......150.--......160--........170.......180.......190...--....200........210.......220......----.230.......240.......250.......260.--......270.......280.......290.------.-.....300.......310.......320.......330.......340.......350.......360.......370.......380.......390.......400.......410.......420......
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTK-SLNAFNVGD-DCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIG--ILELLKY-H--PRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKY--GNYFFP-GTGDMYEVGAESGRYYCLNVPLRDGID----DQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGC--DRLGCFNLSIRGHGECVEYVKSFNIPLLVL------G-GGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
21 PsiBlast_CBE 95.56100%-144 - C2 - - 4A69 HDAC3_HUMAN B:[2-370] -AKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTK-SLNAFNVGD-DCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIG--ILELLKY-H--PRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKY--GNYFFP-GTGDMYEVGAESGRYYCLNVPLRDGID----DQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGC--DRLGCFNLSIRGHGECVEYVKSFNIPLLVL------G-GGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLN----------------------------------------------------------
152 HHSearch 95.40100%-144 - C2 - - 4A69 HDAC3_HUMAN A:[2-370] -AKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTK-SLNAFNVGD-DCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIG--ILELLKY-H--PRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKY--GNYFFP-GTGDMYEVGAESGRYYCLNVPLRDGID----DQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGC--DRLGCFNLSIRGHGECVEYVKSFNIPLLVL------G-GGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLN----------------------------------------------------------
1 PsiBlast_PDB 95.40100%-144 - C2 - - 4A69 HDAC3_HUMAN A:[2-370] -AKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTK-SLNAFNVGD-DCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIG--ILELLKY-H--PRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKY--GNYFFP-GTGDMYEVGAESGRYYCLNVPLRDGID----DQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGC--DRLGCFNLSIRGHGECVEYVKSFNIPLLVL------G-GGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLN----------------------------------------------------------
3 PsiBlast_PDB 83.9063%-122 - C2 - - 5ICN HDAC1_HUMAN B:[9-376] --RKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSK-QMQRFNVGE-DCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLA--ILELLKY-H--QRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKY--GEY-FP-GTGDLRDIGAGKGKYYAVNYPLRDGID----DESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSG--DRLGCFNLTIKGHAKCVEFVKSFNLPMLML------G-GGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSN-MTNQNTNEYLEKIKQRLFENLRMLPHA--------------------------------------------------------
2 PsiBlast_PDB 83.2062%-121 - C2 - - 4BKX HDAC1_HUMAN B:[9-376] --RKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSK-QMQRFNVGE-DCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLA--ILELLKY-H--QRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKY--GEY-FP-GTGDLRDIGAGKGKYYAVNYPLRDGID----DESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSG--DRLGCFNLTIKGHAKCVEFVKSFNLPMLML------G-GGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSN-MTNQNTNEYLEKIKQRLFENLRMLPHA--------------------------------------------------------
4 PsiBlast_PDB 83.1463%-124 - C2 - - 4LXZ HDAC2_HUMAN A:[3-368] --KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSK-QMQRFNVGE-DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLA--ILELLKY-H--QRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKY--GEY-FP-GTGDLRDIGAGKGKYYAVNFPMRDGID----DESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSG--DRLGCFNLTVKGHAKCVEVVKTFNLPLLML------G-GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSN-MTNQNTPEYMEKIKQRLFENLRMLP----------------------------------------------------------
23 PsiBlast_CBE 82.9163%-126 - C2 - - 4LY1 HDAC2_HUMAN B:[3-368] --KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSK-QMQRFNVGE-DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLA--ILELLKY-H--QRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKY--GEY-FP-GTGDLRDIGAGKGKYYAVNFPMRDGID----DESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSG--DRLGCFNLTVKGHAKCVEVVKTFNLPLLML------G-GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSN-MTNQNTPEYMEKIKQRLFENLRMLP----------------------------------------------------------
7 PsiBlast_PDB 82.8463%-124 - C2 - - 5IX0 HDAC2_HUMAN A:[4-368] --KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSK-QMQRFNVGE-DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLA--ILELLKY-H--QRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKY--GEY-FP-GTGDLRDIGAGKGKYYAVNFPMRDGID----DESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSG--DRLGCFNLTVKGHAKCVEVVKTFNLPLLML------G-GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSN-MTNQNTPEYMEKIKQRLFENLRML-----------------------------------------------------------
29 PsiBlast_CBE 82.7763%-127 - C2 - - 5IX0 HDAC2_HUMAN B:[4-368] --KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSK-QMQRFNVGE-DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLA--ILELLKY-H--QRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKY--GEY-FP-GTGDLRDIGAGKGKYYAVNFPMRDGID----DESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSG--DRLGCFNLTVKGHAKCVEVVKTFNLPLLML------G-GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSN-MTNQNTPEYMEKIKQRLFENLRML-----------------------------------------------------------
31 PsiBlast_CBE 82.4663%-124 - C2 - - 5IWG HDAC2_HUMAN B:[3-367] --KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSK-QMQRFNVGE-DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLA--ILELLKY-H--QRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKY--GEY-FP-GTGDLRDIGAGKGKYYAVNFPMRDGID----DESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSG--DRLGCFNLTVKGHAKCVEVVKTFNLPLLML------G-GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSN-MTNQNTPEYMEKIKQRLFENLRML-----------------------------------------------------------
22 PsiBlast_CBE 82.3963%-125 - C2 - - 4LY1 HDAC2_HUMAN C:[3-367] --KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSK-QMQRFNVGE-DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLA--ILELLKY-H--QRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKY--GEY-FP-GTGDLRDIGA