@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : A0A125YPH2_TOXGG: (2017-06-15 )
MALSALRKRVAYFYDPDIGSYYYGPGHPMKPQRIRMAHALVLSYDLYKHMEVYRPHKSIEPELCLFHSSDYISFLSSVSPENYKEFSLQLKNFNVGEATDCPVFDGLFTFQQACAGASIDAAKKLNHHQADICVNWSGGLHHAKRSEASGFCYINDIVLGILELLKYHARVMYIDIDIHHGDGVEEAFYVSHRVMTVSFHKFGDFFPGTGDVTDVGASQGKYYAVNVPLNDGMDDDSFVALFKPVITKCVDVYRPGAIVLQCGADSLTGDRLGKFNLTIKGHAACVAFVKSLDIPLLVLGGGGYTIRNVARCWAYETGVVLDRHREMSPHVPLNDYYDYYAPDFQLHLTPSSIPNSNSPEHLEKIKTRVLSNLSYLEHAPGVQFAYVPPDFFGEDNDDEDEFMQNQVDNEGGGRAAGATAHTAANAPYRIRRKDYANDFEDMADRDQKVPI

Atome Classification :

(102 SA) .........10........20........30........40........50........60........70....-----....80........90........100.......110.......120.......130.......140.......150.......160.......-..170.......180.......190.......200--.-.-.-..-..210.......220.......230..----.....240.......250.......260.......--270.......280.......290.......300.......310.......320.....-..330.......340.......350-.......360.......370.......380.......390.......400.......410.......420.......430.......440.......450
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) MALSALRKRVAYFYDPDIGSYYYGPGHPMKPQRIRMAHALVLSYDLYKHMEVYRPHKSIEPELCLFHSSDYISFL-----SSVSPENYKEFSLQLKNFNVGEATDCPVFDGLFTFQQACAGASIDAAKKLNHHQADICVNWSGGLHHAKRSEASGFCYINDIVLG--ILELLKY-HARVMYIDIDIHHGDGVEEAFYVSHRVMTVSFHKF--G-D-F-FP-GTGDVTDVGASQGKYYAVNVPLNDGMD----DDSFVALFKPVITKCVDVYRPGAIVLQCGADSLTG--DRLGKFNLTIKGHAACVAFVKSLDIPLLVLGGGGYTIRNVARCWAYETGVVLDRHREM-SPHVPLNDYYDYYAPDFQLHLTPSS-IPNSNSPEHLEKIKTRVLSNLSYLEHAPGVQFAYVPPDFFGEDNDDEDEFMQNQVDNEGGGRAAGATAHTAANAPYRIRRKDYANDFEDMADRDQKVPI
6 PsiBlast_PDB 94.6564%-120 - C2 - - 5IWG HDAC2_HUMAN A:[2-367] ------KKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFL-----RSIRPDNMSEYSKQMQRFNVGE--DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLA--ILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKY--G-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGID----DESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSG--DRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALD--CEI-PNELPYNDYFEYFGPDFKLHISPSN-MTNQNTPEYMEKIKQRLFENLRML---------------------------------------------------------------------------
30 PsiBlast_CBE 93.6064%-122 - C2 - - 5IX0 HDAC2_HUMAN B:[4-368] -------KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFL-----RSIRPDNMSEYSKQMQRFNVGE--DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLA--ILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKY--G-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGID----DESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSG--DRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALD--CEI-PNELPYNDYFEYFGPDFKLHISPSN-MTNQNTPEYMEKIKQRLFENLRML---------------------------------------------------------------------------
7 PsiBlast_PDB 93.6064%-120 - C2 - - 5IX0 HDAC2_HUMAN A:[3-368] ------KKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFL-----RSIRPDNMSEYSKQMQRFNVGE--DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLA--ILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKY--G-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGID----DESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSG--DRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALD--CEI-PNELPYNDYFEYFGPDFKLHISPSN-MTNQNTPEYMEKIKQRLFENLRML---------------------------------------------------------------------------
5 PsiBlast_PDB 93.2964%-121 - C2 - - 3MAX HDAC2_HUMAN A:[2-367] ------KKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFL-----RSIRPDNMSEYSKQMQRFNVGE--DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLA--ILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKY--G-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGID----DESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSG--DRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALD--CEI-PNELPYNDYFEYFGPDFKLHISPSN-MTNQNTPEYMEKIKQRLFENLRML---------------------------------------------------------------------------
29 PsiBlast_CBE 93.1664%-124 - C2 - - 5IX0 HDAC2_HUMAN C:[4-368] -------KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFL-----RSIRPDNMSEYSKQMQRFNVGE--DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLA--ILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKY--G-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGID----DESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSG--DRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALD--CEI-PNELPYNDYFEYFGPDFKLHISPSN-MTNQNTPEYMEKIKQRLFENLRML---------------------------------------------------------------------------
26 PsiBlast_CBE 93.0164%-122 - C2 - - 3MAX HDAC2_HUMAN B:[4-367] --------KVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFL-----RSIRPDNMSEYSKQMQRFNVGE--DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLA--ILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKY--G-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGID----DESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSG--DRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALD--CEI-PNELPYNDYFEYFGPDFKLHISPSN-MTNQNTPEYMEKIKQRLFENLRML---------------------------------------------------------------------------
27 PsiBlast_CBE 92.9664%-124 - C2 - - 5IWG HDAC2_HUMAN C:[3-367] -------KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFL-----RSIRPDNMSEYSKQMQRFNVGE--DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLA--ILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKY--G-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGID----DESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSG--DRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALD--CEI-PNELPYNDYFEYFGPDFKLHISPSN-MTNQNTPEYMEKIKQRLFENLRML---------------------------------------------------------------------------
2 PsiBlast_PDB 92.9564%-120 - C2 - - 5ICN HDAC1_HUMAN B:[8-376] ------RRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFL-----RSIRPDNMSEYSKQMQRFNVGE--DCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLA--ILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKY--G-E-Y-FP-GTGDLRDIGAGKGKYYAVNYPLRDGID----DESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSG--DRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALD--TEI-PNELPYNDYFEYFGPDFKLHISPSN-MTNQNTNEYLEKIKQRLFENLRMLPHA------------------------------------------------------------------------
28 PsiBlast_CBE 92.8464%-120 - C2 - - 5IWG HDAC2_HUMAN B:[3-367] -------KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFL-----RSIRPDNMSEYSKQMQRFNVGE--DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLA--ILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKY--G-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGID----DESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSG--DRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALD--CEI-PNELPYNDYFEYFGPDFKLHISPSN-MTNQNTPEYMEKIKQRLFENLRML---------------------------------------------------------------------------
25 PsiBlast_CBE 92.7364%-120 - C2 - - 3MAX HDAC2_HUMAN C:[2-367] ------KKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFL-----RSIRPDNMSEYSKQMQRFNVGE--DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLA--ILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKY--G-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGID----DESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSG--DRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALD--CEI-PNELPYNDYFEYFGPDFKLHISPSN-MTNQNTPEYMEKIKQRLFENLRML---------------------------------------------------------------------------
22 PsiBlast_CBE 92.6763%-121 - C2 - - 4LY1 HDAC2_HUMAN B:[2-368] ------KKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFL-----RSIRPDNMSEYSKQMQRFNVGE--DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLA--ILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKY--G-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGID----DESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSG--DRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALD--CEI-PNELPYNDYFEYFGPDFKLHISPSN-MTNQNTPEYMEKIKQRLFENLRMLP--------------------------------------------------------------------------
21 PsiBlast_CBE 92.6563%-121 - C2 - - 4LY1 HDAC2_HUMAN C:[2-367] ------KKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFL-----RSIRPDNMSEYSKQMQRFNVGE--DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLA--ILELLKY-HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKY--G-E-Y-FP-GTGDLRDIGAGKGKYYAVNFPMRDGID----DESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSG--DRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALD--CEI-PNELPYNDYFEYFGPDFKLHISPSN-MTNQNTPEYMEKIKQRLFENLRML---------------------------------------------------------------------------