@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : LINJ_35_1030: (2018-07-13 )
MNVELRVGNRYRIGQKIGSGSFGEIFRGTNIQTGDPVAIKLEQVKTRHPQLTYESRFYRILGSGGGAVGIPMMFYHGVEGEFNVMVIELLGPSLEDLFSFCGRRLSLKTTLMLADQMISRIEFVHSKSVLHRDIKPDNFLMGTGKKGHHVYIIDFGLAKKYRDPRTHAHIPYKEGKSLTGTARYCSINTHMGVEQGRRDDMEGIGYILMYFLRGSLPWQGLKAHTKQEKYNRISERKQTTPVELLCKGFPSEFAAYMNYVRALRFEDKPDYSYLKRMFRDLFVREGYHVDYVFDWTLKRIHESLQEQQSFPGGSNGGGAAGNGSPVNQSPAQGGNGGAPNSANNQESGAQEQQ

Atome Classification :

(49 SA) .........10........20........30........40........50........60........70........80........90........100........110.......120.......130.......140.-.-.--.--...150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290.......300.......310.......320.......330.......340.......350.----------
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) MNVELRVGNRYRIGQKIGSGSFGEIFRGTNIQTGDPVAIKLEQVKTRHPQLTYESRFYRILGSGGGAVGIPMMFYHGVEGEFNVMVIELLGPSLEDLFSFC-GRRLSLKTTLMLADQMISRIEFVHSKSVLHRDIKPDNFLMGT-G-K--K--GHHVYIIDFGLAKKYRDPRTHAHIPYKEGKSLTGTARYCSINTHMGVEQGRRDDMEGIGYILMYFLRGSLPWQGLKAHTKQEKYNRISERKQTTPVELLCKGFPSEFAAYMNYVRALRFEDKPDYSYLKRMFRDLFVREGYHVDYVFDWTLKRIHESLQEQQSFPGGSNGGGAAGNGSPVNQSPAQGGNGGAPNSANNQESGAQEQQ----------
71 HHSearch 93.5271% -97 - C1 - - 3SV0 - ? A:[2-295] ---EPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQGG---TGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFC-SRKLSLKTVLMLADQMINRVEFVHSKSFLHRDIKPDNFLMGL-G-R--R--ANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTGTARYASVNTHLGIEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYEKISEKKVATSIEALCRGYPTEFASYFHYCRSLRFDDKPDYSYLKRLFRDLFIREGFQFDYVFDWTILKY---------------------------------------------------------------
63 PsiBlast_CBE 93.3168% -96 - C1 - - 4KBA KC1D_HUMAN B:[17-307] ----LRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLEC------QLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML-----------------------------------------------------------------
66 PsiBlast_CBE 93.1068% -98 - C1 - - 4KB8 KC1D_HUMAN B:[17-307] ----LRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLEC------QLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML-----------------------------------------------------------------
1 PsiBlast_PDB 91.8365% -97 - C1 - - 3SV0 - ? A:[2-295] ---EPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ---GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFC-SRKLSLKTVLMLADQMINRVEFVHSKSFLHRDIKPDNFLMGL-G-R--R--ANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTGTARYASVNTHLGIEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYEKISEKKVATSIEALCRGYPTEFASYFHYCRSLRFDDKPDYSYLKRLFRDLFIREGFQFDYVFDWTILKY---------------------------------------------------------------
5 PsiBlast_PDB 91.7768% -98 - C1 - - 3UYT KC1D_HUMAN A:[7-294] ------VGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVK---PQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNM------------------------------------------------------------------
60 PsiBlast_CBE 91.4768%-102 - C1 - - 4KBK KC1D_HUMAN A:[17-307] ----LRVGNRYRLGRKIGSG--GDIYLGTDIAAGEEVAIKLEC------QLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML-----------------------------------------------------------------
10 PsiBlast_PDB 91.3769% -96 - C1 - - 5X17 KC1D_MOUSE A:[5-294] ----LRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNM------------------------------------------------------------------
42 PsiBlast_CBE 91.0969% -97 - C1 - - 5X17 KC1D_MOUSE B:[6-294] -----RVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNM------------------------------------------------------------------
11 PsiBlast_PDB 91.0569%-104 - C1 - - 4TW9 KC1D_HUMAN A:[2-292] ---ELRVGNRYRLGNKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAA----KYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNM------------------------------------------------------------------
12 PsiBlast_PDB 90.9769% -94 - C1 - - 4TWC KC1D_HUMAN A:[2-292] ---ELRVGNRYRLGNKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLK-ATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNM------------------------------------------------------------------
17 PsiBlast_PDB 90.9369%-102 - C1 - - 4TN6 KC1D_HUMAN A:[2-292] ---ELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNM------------------------------------------------------------------
56 PsiBlast_CBE 90.9268% -95 - C1 - - 5W4W KC1D_HUMAN A:[17-307] ----LRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML-----------------------------------------------------------------
70 HHSearch 90.8670% -94 - C1 - - 4TWC KC1D_HUMAN A:[2-294] ---ELRVGNRYRLGNKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQGG---VGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLK-ATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLK----------------------------------------------------------------
57 PsiBlast_CBE 90.7168%-108 - C1 - - 4KBK KC1D_HUMAN D:[17-307] ----LRVGNRYRLGRKIG-----DIYLGTDIAAGEEVAIKLEC-----PQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML-----------------------------------------------------------------
38 PsiBlast_CBE 90.4968% -99 - C1 - - 3UYT KC1D_HUMAN B:[7-294] ------VGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVK---PQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNM------------------------------------------------------------------
44 PsiBlast_CBE 90.3769%-100 - C1 - - 4TW9 KC1D_HUMAN B:[1-292] --MELRVGNRYRLGNKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLK------KYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNM------------------------------------------------------------------
35 PsiBlast_CBE 90.3468% -99 - C1 - - 3UZP KC1D_HUMAN B:[5-294] ----LRVGNRYRLGRKIGSG---DIYLGTDIAAGEEVAIKLECVKT-----HIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNM------------------------------------------------------------------
55 PsiBlast_CBE 90.2568% -94 - C1 - - 5W4W KC1D_HUMAN B:[17-307] ----LRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML-----------------------------------------------------------------
14 PsiBlast_PDB 90.0169% -96 - C1 - - 1CKJ - KC1D_RAT A:[1-292] --MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNM------------------------------------------------------------------
16 PsiBlast_PDB 89.8769% -95 - C1 - - 4KBC KC1D_HUMAN A:[2-292] ---ELRVGNRYRLGRKIGS----DIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNM------------------------------------------------------------------
7 PsiBlast_PDB 89.7268%-101 - C1 - - 4HNF KC1D_HUMAN A:[5-294] ----LRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVK---PQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNM------------------------------------------------------------------
6 PsiBlast_PDB 89.6868% -95 - C1 - - 3UZP KC1D_HUMAN A:[5-294] ----LRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNM------------------------------------------------------------------
43 PsiBlast_CBE 89.6169% -90 - C1 - - 4TWC KC1D_HUMAN B:[1-292] --MELRVGNRYRLGNKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKA---RQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNM------------------------------------------------------------------
61 PsiBlast_CBE 89.2568%-110 - C1 - - 4KBA KC1D_HUMAN D:[17-307] ----LRVGNRYRLGRKIG-----DIYLGTDIAAGEEVAIKLEC-----PQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKY-------HIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML-----------------------------------------------------------------
33 PsiBlast_CBE 89.1868% -93 - C1 - - 4HNF KC1D_HUMAN B:[7-294] ------VGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNM------------------------------------------------------------------
37 PsiBlast_CBE 89.0768% -98 - C1 - - 3UYT KC1D_HUMAN C:[6-294] -----RVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRD-----HIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNM------------------------------------------------------------------
59 PsiBlast_CBE 88.9668%-100 - C1 - - 4KBK KC1D_HUMAN B:[17-307] ----LRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYR--KNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML-----------------------------------------------------------------
64 PsiBlast_CBE 88.9468%-109 - C1 - - 4KB8 KC1D_HUMAN D:[17-307] ----LRVGNRYRLGRKIG-----DIYLGTDIAAGEEVAIKLEC-----PQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDA---QHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML-----------------------------------------------------------------
53 PsiBlast_CBE 88.8668% -95 - C1 - - 5W4W KC1D_HUMAN D:[17-307] ----LRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECV----PQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML-----------------------------------------------------------------
34 PsiBlast_CBE 88.8668%-101 - C1 - - 4HGT KC1D_HUMAN B:[4-294] ---ELRVGNRYRLGRKI------DIYLGTDIAAGEEVAIKLECV-----QLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNM------------------------------------------------------------------
9 PsiBlast_PDB 88.8369%-102 - C1 - - 5IH6 KC1D_HUMAN A:[2-292] ---ELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGL------QKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNM------------------------------------------------------------------
69 HHSearch 88.7770% -89 - C1 - - 4TWC KC1D_HUMAN B:[2-294] ---ELRVGNRYRLGNKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQGG---VGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKA---RQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLK----------------------------------------------------------------
58 PsiBlast_CBE 88.4668%-105 - C1 - - 4KBK KC1D_HUMAN C:[18-307] -----RVGNRYRLGRKIGS---GDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKY-------HIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML-----------------------------------------------------------------
54 PsiBlast_CBE 88.0868% -94 - C1 - - 5W4W KC1D_HUMAN C:[18-307] -----RVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYR-----QHIPYRE-KNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML-----------------------------------------------------------------
8 PsiBlast_PDB 87.5268%-101 - C1 - - 4HGT KC1D_HUMAN A:[11-294] ----------YRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECV---HPQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNM------------------------------------------------------------------
91 Fugue 87.4553% -80 - C1 - - 4XHG ? A:[2-397] ---DLRVGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIRLESIRSRHPQLDYESRVYKYLS---GGVGIPFIRWFGREGEYNAMVIDLLGPSLEDLFNYC-HRKFSFKTVIMLALQMICRVQYIHGRSFIHRDIKPDNFLMGV-G-R--R--GSTVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYASVNTHLGIEQSRRDDLESLGYMLIYFCKGSLPWQGLKATTKKQKYDRILEKKLCISVETLCAGLPLEFSEYMNYCRNLKFDERPDYLYLARLFKDLSIKLEYHNDHLFDWTMLRYTKAMVEKKNDSFNKVKLLAMKKFASHFHYCKNDDKHYPTPEEIKQQTVQNNNAAPELLSAIDK
32 PsiBlast_CBE 87.4568% -96 - C1 - - 4HNI KC1E_HUMAN B:[3-294] --MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECV---------ESKFYKMMQ---GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNM------------------------------------------------------------------
2 PsiBlast_PDB 87.3568% -94 - C1 - - 4HNI KC1E_HUMAN A:[5-294] ----LRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECV-------HIESKFYKMMQ---GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNM------------------------------------------------------------------
45 PsiBlast_CBE 86.7669% -98 - C1 - - 4KBC KC1D_HUMAN B:[1-291] --MELRV---YRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLE----KHPQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLK-------YERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWN-------------------------------------------------------------------
62 PsiBlast_CBE 86.2568% -95 - C1 - - 4KBA KC1D_HUMAN C:[21-307] --------NRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKY----------YRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML-----------------------------------------------------------------
65 PsiBlast_CBE 85.7568% -96 - C1 - - 4KB8 KC1D_HUMAN C:[21-307] --------NRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKY----------YRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML-----------------------------------------------------------------
36 PsiBlast_CBE 84.1468%-106 - C1 - - 3UYT KC1D_HUMAN D:[6-294] -----RVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKYR----------------TGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLK-------YERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNM------------------------------------------------------------------
19 PsiBlast_PDB 84.0368%-112 - C1 - - 4KB8 KC1D_HUMAN A:[17-307] ----LRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKY------------------GTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLK--------ERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML-----------------------------------------------------------------
20 PsiBlast_PDB 82.9568%-110 - C1 - - 4KBA KC1D_HUMAN A:[17-307] ----LRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ---GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFC-SRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL-G-K--K--GNLVYIIDFGLAKKY------------------GTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGL----------RISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML-----------------------------------------------------------------
73 HHSearch 77.6752% -56 - C1 - - 5X18 KC11_YEAST B:[4-294] -----IVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGT---PNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWC-GRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGR-P-GQPD--ANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLAQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMK------------------------------------------------------------------</