@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : LINJ_35_1720: (2018-07-13 )
MSSRSSPKSPASDGAHRYAHVNVNKPSSYWDYDSLRVQWNSPDRYEVVQKIGRGKYSDVFLGVDTKVPRQVVIKVLKPVKKKKILRELMVLQTLKGGPNIVDLFDVVREPNSKTPSFVFEYVKSCDFRTVFPTFTDLEVRSYIFQVLMALEYAHSHGIMHRDVKPNNVCLDYKTGKLKLIDWGLAEFYHPATSYNARVASRYFKGPELLVELPMYDYRLDMWSLGCMLAAMIFIREPFFRGKDNTDQLVRIVKVLGTDDLQVYLKKHNASLPPVLEATLGYHAKKPWRSFVNGQNEHLCPPEALAFLDKLLQYDHMKRIQAAEAMMDPYFDPVRPKDFTLDGITVAAENGGGGASVCNEENVHEKRVPRIES

Atome Classification :

(56 SA) .........10........20........30........40-........50........60........70......---..80........90....--------------------------------------....100.......110....----...120.......130-.......140.......150....-...160.......170........180.......190-----.......200.......210.--......220.......230.-......240.......250.......260.......270.......280.......290-.-.......300.......310.......320.......330.......340.......350.......360.......370-
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) MSSRSSPKSPASDGAHRYAHVNVNKPSSYWDYDSLRVQWNS-PDRYEVVQKIGRGKYSDVFLGVDTKVPRQVVIKVLK---PVKKKKILRELMVLQTLK--------------------------------------GGPNIVDLFDVVREPNSKTPS----FVFEYVKSCDFRTVFP-TFTDLEVRSYIFQVLMALEYAHSH-GIMHRDVKPNNVCLD-YKTGKLKLIDWGLAEFYHPAT-----SYNARVASRYFKGPELLVELP--MYDYRLDMWSLGCMLAAMIF-IREPFFRGKDNTDQLVRIVKVLGTDDLQVYLKKHNASLPPVLEATLGYHAKKPWRSFV--N-GQNEHLCPPEALAFLDKLLQYDHMKRIQAAEAMMDPYFDPVRPKDFTLDGITVAAENGGGGASVCNEENVHEKRVPRIES-
28 PsiBlast_CBE 96.3861%-134 - C1 - - 1ZOH CSK2A_MAIZE A:[4-326] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
54 PsiBlast_CBE 95.8861%-133 - C1 - - 3PVG CSK2A_MAIZE A:[3-325] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
21 PsiBlast_CBE 95.7961%-126 - C1 - - 4ANM CSK2A_MAIZE A:[2-327] -----------SSKARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
32 PsiBlast_CBE 95.7761%-132 - C1 - - 1LR4 CSK2A_MAIZE A:[4-326] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
23 PsiBlast_CBE 95.7561%-134 - C1 - - 3PWD CSK2A_MAIZE A:[4-326] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
56 PsiBlast_CBE 95.5161%-132 - C1 - - 3KXG CSK2A_MAIZE A:[3-325] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
53 PsiBlast_CBE 95.4761%-130 - C1 - - 2QC6 CSK2A_MAIZE A:[4-326] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
24 PsiBlast_CBE 95.4061%-137 - C1 - - 2OXY CSK2A_MAIZE B:[4-326] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
43 PsiBlast_CBE 95.2561%-136 - C1 - - 3KXN CSK2A_MAIZE A:[3-325] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
25 PsiBlast_CBE 95.2161%-138 - C1 - - 2OXY CSK2A_MAIZE A:[4-326] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
35 PsiBlast_CBE 95.0861%-130 - C1 - - 1J91 CSK2A_MAIZE B:[4-326] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
31 PsiBlast_CBE 95.0561%-132 - C1 - - 1OM1 CSK2A_MAIZE A:[4-326] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
58 HHSearch 94.8562%-141 - C1 - - 3KXH CSK2A_MAIZE A:[5-324] ----------------VYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAA-------------------------------------
59 HHSearch 94.8462%-130 - C1 - - 4RLK CSK2A_MAIZE A:[7-326] -----------------YADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
48 PsiBlast_CBE 94.8261%-132 - C1 - - 1DAW CSK2A_MAIZE A:[3-325] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
51 PsiBlast_CBE 94.7761%-132 - C1 - - 3PZH CSK2A_MAIZE A:[4-326] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
22 PsiBlast_CBE 94.6361%-129 - C1 - - 4RLK CSK2A_MAIZE A:[4-326] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
33 PsiBlast_CBE 94.5561%-133 - C1 - - 1LPU CSK2A_MAIZE A:[4-326] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
57 PsiBlast_CBE 94.4161%-129 - C1 - - 4DGN CSK2A_MAIZE A:[3-325] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
55 PsiBlast_CBE 94.4061%-139 - C1 - - 3KXH CSK2A_MAIZE A:[3-325] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
30 PsiBlast_CBE 94.3861%-133 - C1 - - 1ZOE CSK2A_MAIZE A:[4-326] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
36 PsiBlast_CBE 94.3161%-135 - C1 - - 1J91 CSK2A_MAIZE A:[4-326] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
49 PsiBlast_CBE 94.0061%-130 - C1 - - 4DGO CSK2A_MAIZE A:[3-325] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
34 PsiBlast_CBE 93.8461%-132 - C1 - - 1LP4 CSK2A_MAIZE A:[4-326] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
45 PsiBlast_CBE 93.7861%-131 - C1 - - 1M2R CSK2A_MAIZE A:[3-325] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
44 PsiBlast_CBE 93.7061%-128 - C1 - - 3KXM CSK2A_MAIZE A:[3-325] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
50 PsiBlast_CBE 93.6961%-130 - C1 - - 1M2P CSK2A_MAIZE A:[3-325] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
27 PsiBlast_CBE 93.5361%-129 - C1 - - 2OXD CSK2A_MAIZE A:[4-326] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
46 PsiBlast_CBE 93.4461%-132 - C1 - - 1M2Q CSK2A_MAIZE A:[3-325] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
42 PsiBlast_CBE 93.1161%-129 - C1 - - 4DGM CSK2A_MAIZE A:[3-325] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLM--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
37 PsiBlast_CBE 92.8461%-126 - C1 - - 1F0Q CSK2A_MAIZE A:[4-326] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
47 PsiBlast_CBE 92.6761%-133 - C1 - - 1DAY CSK2A_MAIZE A:[3-325] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
5 PsiBlast_PDB 92.3357%-134 - C1 - - 5OTQ ? A:[2-323] --------GPVPSRARVYTDVNTHRPSEYWDYESHVVEWGN-QDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILK---PVAAAKIKREIKILENLR--------------------------------------GGPNIITLADIVKDPVSRTPA----LVFEHVNNTDFKQLYQ-TLTDYDIRFYMYEILKALDYCHSM-GIMHRDVKPHNVMID-HEHRKLRLIDWGLAEFYHPGQ-----EYNVRVASRYFKGPELLVDYQ--MYDYSLDMWSLGCMLASMIF-RKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFV--H-SENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYF-------------------------------------------
10 PsiBlast_PDB 92.0157%-130 - C1 - - 5OYF ? A:[2-323] --------GPVPSRARVYTDVNTHRPSEYWDYESHVVEWGN-QDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILK---PVAAAKIKREIKILENLR--------------------------------------GGPNIITLADIVKDPVSRTPA----LVFEHVNNTDFKQLYQ-TLTDYDIRFYMYEILKALDYCHSM-GIMHRDVKPHNVMID-HEHRKLRLIDWGLAEFYHPGQ-----EYNVRVASRYFKGPELLVDYQ--MYDYSLDMWSLGCMLASMIF-RKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFV--H-SENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYF-------------------------------------------
2 PsiBlast_PDB 91.7257%-128 - C1 - - 5OSL ? A:[2-323] --------GPVPSRARVYTDVNTHRPSEYWDYESHVVEWGN-QDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILK---PVAAAKIKREIKILENLR--------------------------------------GGPNIITLADIVKDPVSRTPA----LVFEHVNNTDFKQLYQ-TLTDYDIRFYMYEILKALDYCHSM-GIMHRDVKPHNVMID-HEHRKLRLIDWGLAEFYHPGQ-----EYNVRVASRYFKGPELLVDYQ--MYDYSLDMWSLGCMLASMIF-RKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFV--H-SENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYF-------------------------------------------
29 PsiBlast_CBE 91.6761%-124 - C1 - - 1ZOG CSK2A_MAIZE A:[4-326] --------------ARVYADVNVLRPKEYWDYEALTVQWGE-QDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILK---PVKKKKIKREIKILQNLC--------------------------------------GGPNIVKLLDIVRDQHSKTPS----LIFEYVNNTDFKVLYP-TLTDYDIRYYIYELLKALDYCHSQ-GIMHRDVKPHNVMID-HELRKLRLIDWGLAEFYHPGK-----EYNVRVASRYFKGPELLVDLQ--DYDYSLDMWSLGCMFAGMIF-RKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFM--N-ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE------------------------------------
15 PsiBlast_PDB 91.3657%-132 - C1 - - 5CU4 CSK21_HUMAN A:[2-323] --------GPVPSRARVYTDVNTHRPSEYWDYESHVVEWGN-QDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILK---PVAAAKIKREIKILENLR--------------------------------------GGPNIITLADIVKDPVSRTPA----LVFEHVNNTDFKQLYQ-TLTDYDIRFYMYEILKALDYCHSM-GIMHRDVKPHNVMID-HEHRKLRLIDWGLAEFYHPGQ-----EYNVRVASRYFKGPELLVDYQ--MYDYSLDMWSLGCMLASMIF-RKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFV--H-SENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYF-------------------------------------------
20 PsiBlast_PDB 91.2557%-131 - C1 - - 5OS8 ? A:[2-323] --------GPVPSRARVYTDVNTHRPSEYWDYESHVVEWGN-QDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILK---PVAAAKIKREIKILENLR--------------------------------------GGPNIITLADIVKDPVSRTPA----LVFEHVNNTDFKQLYQ-TLTDYDIRFYMYEILKALDYCHSM-GIMHRDVKPHNVMID-HEHRKLRLIDWGLAEFYHPGQ-----EYNVRVASRYFKGPELLVDYQ--MYDYSLDMWSLGCMLASMIF-RKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFV--H-SENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYF-------------------------------------------