@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : TBB2A_HUMAN: (2018-10-06 )
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA

Atome Classification :

(23 SA) .........10........20........30........40...---.....50........60........70........80........90..--......100.......110.......120.......130.......140.......150.......160.......170..-.....180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280........290.......300...-....310.......320.......330.......340.......350......-.360------.........370.......380.......390.......400.......410--........420.......430.......440...
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK-VSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDSKNMMAACDP-RHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA
2 PsiBlast_PDB 94.3199% -85 - C2 - - 4HNA ? B:[1-431] MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK-VSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDSKNMMAACDP-RHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQDATAD--------------
5 PsiBlast_PDB 93.3699% -84 - C2 - - 5EIB TBB2B_BOVIN D:[2-431] -REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK-VSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDSKNMMAACDP-RHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQDATAD--------------
1 PsiBlast_PDB 93.1599% -80 - C2 - - 4F61 ? B:[1-432] MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK-VSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDSKNMMAACDP-RHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQDATADE-------------
18 PsiBlast_PDB 93.0999% -81 - C2 - - 5KX5 ? B:[1-430] MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK-VSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRG----YRALTVPELTQQMFDSKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQDATA---------------
17 PsiBlast_PDB 92.8999% -89 - C2 - - 4X20 ? B:[3-430] --EIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK-VSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDSKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQDATA---------------
16 PsiBlast_PDB 92.8999% -87 - C2 - - 4X1Y ? B:[3-430] --EIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK-VSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDSKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQDATA---------------
3 PsiBlast_PDB 92.8299% -83 - C2 - - 3J8X ? B:[1-431] MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK-VSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDSKNMMAACDP-RHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQDATAD--------------
20 PsiBlast_PDB 92.7499% -88 - C2 - - 4I4T TBB2B_BOVIN B:[1-428] MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTS---------LTVPELTQQMFDSKNMMAACDP-RHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQDA-----------------
38 HHSearch 92.70100% -84 - C2 - - 5IYZ TBB2B_BOVIN D:[1-431] MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSR--------LTVPELTQQMFDSKNMMAACDP-RHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQDATAD--------------
14 PsiBlast_PDB 92.6999% -90 - C2 - - 4X1I ? B:[3-430] --EIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK-VSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDSKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQDATA---------------
15 PsiBlast_PDB 92.2499% -91 - C2 - - 4X1K ? B:[3-430] --EIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK-VSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDSKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQDATA---------------
4 PsiBlast_PDB 91.9599% -77 - C2 - - 3J8Y ? B:[1-431] MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK-VSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDSKNMMAACDP-RHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQDATAD--------------
13 PsiBlast_PDB 89.9899% -83 - C2 - - 3N2K ? B:[2-429] -REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK-VSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTS---------LTVPELTQQMFDSKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQDAT----------------
12 PsiBlast_PDB 89.7599% -85 - C2 - - 3N2G ? B:[2-428] -REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK-VSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTS---------LTVPELTQQMFDSKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQDA-----------------
10 PsiBlast_PDB 89.3699% -79 - C2 - - 3HKD ? B:[2-429] -REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK-VSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTS---------LTVPELTQQMFDSKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQDAT----------------
19 PsiBlast_PDB 89.0399% -83 - C2 - - 1Z2B TBB2B_BOVIN B:[2-428] -REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK-VSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTS---------LTVPELTQQMFDSKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQDA-----------------
40 HHSearch 88.9097% -82 - C2 - - 5N5N TBB5_HUMAN E:[1-425] MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL---DRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQVFDAKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQY--------------------
8 PsiBlast_PDB 88.3499% -81 - C2 - - 3HKB ? B:[2-429] -REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK-VSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTS---------LTVPELTQQMFDSKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQDAT----------------
11 PsiBlast_PDB 87.4999% -83 - C2 - - 3HKE ? B:[2-429] -REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK-VSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTS---------LTVPELTQQMFDSKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQDAT----------------
6 PsiBlast_PDB 87.3199% -80 - C2 - - 3DU7 TBB2B_BOVIN B:[2-427] -REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK-VSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDSKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQD------------------