@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : TBB4B_HUMAN: (2018-10-06 )
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEFEEEAEEEVA

Atome Classification :

(24 SA) .........10........20........30........40...---.....50........60........70........80........90..--......100.......110.......120.......130.......140.......150.......160.......170..-.....180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280........290.......300...-....310.......320.......330.......340.......350......-.360------.........370.......380.......390.......400.......410--........420.......430.......440...
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL---ERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDAKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQDATAEEEGEFEEEAEEEVA
13 PsiBlast_PDB 86.8498% -92 - C4 - - 5SYG TBB_PIG B:[1-426] MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDAKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQ-------------------
7 PsiBlast_PDB 86.5798% -87 - C4 - - 3J6F TBB_PIG B:[2-427] -REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDAKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQD------------------
1 PsiBlast_PDB 86.3898% -87 - C4 - - 5KMG TBB_PIG B:[1-431] MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDAKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQDATAD--------------
10 PsiBlast_PDB 86.2398% -89 - C4 - - 5SYC TBB_PIG B:[1-426] MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDAKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQ-------------------
14 PsiBlast_PDB 86.2098% - - C4 - - 4UY0 TBB2B_BOVIN B:[1-426] -REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDAKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQD------------------
8 PsiBlast_PDB 85.9798% -93 - C4 - - 3J6G TBB_PIG B:[2-427] -REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDAKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQD------------------
6 PsiBlast_PDB 85.8798% -91 - C4 - - 3J6E TBB_PIG B:[2-427] -REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDAKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQD------------------
40 HHSearch 85.7697% -86 - C4 - - 5IYZ TBB2B_BOVIN D:[1-431] MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSR--------LTVPELTQQMFDSKNMMAACDP-RHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQDATAD--------------
11 PsiBlast_PDB 85.7598% -86 - C4 - - 5SYE TBB_PIG B:[1-426] MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDAKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQ-------------------
12 PsiBlast_PDB 85.6998% -87 - C4 - - 5SYF TBB_PIG B:[1-426] MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDAKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQ-------------------
18 PsiBlast_PDB 85.5098% -93 - C4 - - 5M5C TBB2B_BOVIN E:[1-426] -REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDAKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQD------------------
17 PsiBlast_PDB 85.2198% -92 - C4 - - 5M54 TBB2B_BOVIN E:[1-426] -REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDAKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQD------------------
9 PsiBlast_PDB 84.9098% -93 - C4 - - 5M50 TBB2B_BOVIN E:[2-427] -REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDAKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQD------------------
20 PsiBlast_PDB 84.2198% -84 - C4 - - 5N5N TBB5_HUMAN B:[1-426] MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL---DRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQVFDAKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQ-------------------
39 HHSearch 83.9598% -85 * C4 * - 5N5N TBB5_HUMAN E:[1-425] MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL---DRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQVFDAKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQY--------------------
19 PsiBlast_PDB 83.5798% -74 - C4 - - 5ND4 TBB2B_BOVIN B:[1-426] -REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDAKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQD------------------
16 PsiBlast_PDB 83.3898% -81 - C4 - - 5HNY TBB2B_BOVIN B:[1-424] -REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDAKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQY--------------------
15 PsiBlast_PDB 82.3198% -74 - C4 - - 3J6H TBB_PIG B:[1-426] -REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDAKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQD------------------
3 PsiBlast_PDB 82.2198% -81 - C4 - - 1TVK TBB2B_BOVIN B:[2-427] -REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDAKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQD------------------
5 PsiBlast_PDB 81.5998% -71 - C4 - - 3J1U - TBB2B_BOVIN C:[1-437] MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDAKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQD------------------
2 PsiBlast_PDB 77.2798% -61 - C4 - - 1TUB TBB_PIG B:[1-427] MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL---ERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDAKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQD------------------
21 Fugue 71.8698% 2 - C4 - - 1TUB TBB_PIG B:[1-427] MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERI---NVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFG--QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK-VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ-YRALTVPELTQQMFDAKNMMAACDP-RHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP-RG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEA---ESNMNDLVSEYQQYQD------------------
47 HHSearch 67.9342% -85 - C4 - - 5ND4 TBA1B_BOVIN A:[1-410] -RECISIHVGQAGVQIGNACWELYCLEHGIQP---------------------------DGHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITG--KEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQ-VSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRGHFPLATYAPVISAEKAY-HEQLSVAEITNACFEPANQMVKCDP-RHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPP-TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE