@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : SH2B2_HUMAN: (2017-06-03 )
WFHGTLSRVKAAQLVLAGGPRNHGLFVIRQSETRPGEYVLTFNFQGKAKHLRLSLNGHGQCHVQHLWFQSVLDMLRHF

Atome Classification :

(21 SA) --------------.........10........20........30...-.....40........50........60..--.------.....70.......---------------------
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) --------------WFHGTLSRVKAAQLVLAGGPRNHGLFVIRQSETR-PGEYVLTFNFQGKAKHLRLSLNGHGQCHV--Q------HLWFQSVLDMLRHF---------------------
25 PsiBlast_CBE 91.9976%-185 - C3 - - 2HDX SH2B1_MOUSE B:[11-91] --------------WFHGMLSRLKAAQLVLEGGTGSHGVFLVRQSETR-RGECVLTFNFQGKAKHLRLSLNAAGQCRV--Q------HLHFQSIFDMLEHF---------------------
1 PsiBlast_PDB 91.3496%-156 - C3 - - 1RQQ - SH2B2_RAT C:[13-90] --------------WFHGTLSRVKAAQLVLAGGPRSHGLFVIRQSETR-PGECVLTFNFQGKAKHLRLSLN--GQCHV--Q------HLWFQSVFDMLRHF---------------------
21 PsiBlast_CBE 90.8576%-182 - C3 - - 2HDX F:[11-92] --------------WFHGMLSRLKAAQLVLEGGTGSHGVFLVRQSETR-RGECVLTFNFQGKAKHLRLSLNAAGQCRV--Q------HLHFQSIFDMLEHF---------------------
22 PsiBlast_CBE 90.2676%-182 - C3 - - 2HDX SH2B1_MOUSE E:[11-88] --------------WFHGMLSRLKAAQLVLEGGTGSHGVFLVRQSETR-RGECVLTFNFQGKAKHLRLSLNAAGQCRV--Q------HLHFQSIFDMLEHF---------------------
4 PsiBlast_PDB 89.9676%-185 - C3 - - 2HDX SH2B1_MOUSE A:[11-88] --------------WFHGMLSRLKAAQLVLEGGTGSHGVFLVRQSETR-RGECVLTFNFQGKAKHLRLSLNAAGQCRV--Q------HLHFQSIFDMLEHF---------------------
23 PsiBlast_CBE 88.0676%-180 - C3 - - 2HDX SH2B1_MOUSE D:[11-91] --------------WFHGMLSRLKAAQLVLEGGTGSHGVFLVRQSETR-RGECVLTFNFQGKAKHLRLSLNAAGQCRV--Q------HLHFQSIFDMLEHF---------------------
24 PsiBlast_CBE 87.4676%-181 - C3 - - 2HDX SH2B1_MOUSE C:[11-88] --------------WFHGMLSRLKAAQLVLEGGTGSHGVFLVRQSETR-RGECVLTFNFQGKAKHLRLSLNAAGQCRV--Q------HLHFQSIFDMLEHF---------------------
168 HHSearch 84.8177% 0 - C- - - 2HDV - SH2B1_MOUSE A:[527-611] --------------WFHGMLSRLKAAQLVLEGGTGSHGVFLVRQSETR-RGECVLTFNFQGKAKHLRLSLNAAGQCRV--Q------HLHFQSIFDMLEHF---------------------
2 PsiBlast_PDB 84.3994%-150 - C3 - - 1RPY - SH2B2_RAT A:[13-90] --------------WFHGTLSRVKAAQLVLAGGPRSHGLFVIRQSETR-PGECVLTFNFQGKAKHLRL----HGQCHV--Q------HLWFQSVFDMLRHF---------------------
3 PsiBlast_PDB 84.1976% 0 - C- - - 2HDV - SH2B1_MOUSE A:[527-611] --------------WFHGMLSRLKAAQLVLEGGTGSHGVFLVRQSETR-RGECVLTFNFQGKAKHLRLSLNAAGQCRV--Q------HLHFQSIFDMLEHF---------------------
31 PsiBlast_CBE 71.9631%-165 - C3 - - 1CSZ A:[15-91] --------------WFHGKISREESEQIVLIGSKTN-GKFLIRARDNN--GSYALCLLHEGKVLHYRIDKDKTGKLSIP-E------GKKFDTLWQLVEHY---------------------
32 PsiBlast_CBE 71.5831%-164 - C3 - - 1CSY A:[15-91] --------------WFHGKISREESEQIVLIGSKTN-GKFLIRARDNN--GSYALCLLHEGKVLHYRIDKDKTGKLSIP-E------GKKFDTLWQLVEHY---------------------
181 HHSearch 71.2029%-136 - C3 - - 1D4T - SH21A_HUMAN A:[6-87] --------------VYHGKISRETGEKLLLATG--LDGSYLLRDSESV-PGVYCLCVLYHGYIYTYRVSQTETGSWSA--ETAPGVHKRYFRKIKNLISAF---------------------
180 HHSearch 70.1226%-145 - C3 - - 1I3Z - SH21B_MOUSE A:[5-86] --------------YYHGCLTKRECEALLLKG--GVDGNFLIRDSESV-PGALCLCVSFKKLVYSYRIFREKHGYYRI--ETDAHTPRTIFPNLQELVSKY---------------------
179 HHSearch 69.3529%-137 - C3 - - 1KA6 SH21A_HUMAN A:[6-87] --------------VYHGKISRETGEKLLLATG--LDGSYLLRDSESV-PGVYCLCVLYHGYIYTYRVSQTETGSWSA--ETAPGVHKRYFRKIKNLISAF---------------------
177 HHSearch 69.2429%-173 - C3 - - 3OV1 GRB2_HUMAN A:[8-83] --------------WFFGKIPRAKAEEMLSKQ--RHDGAFLIRESESA-PGDFSLSVKFGNDVQHFKVLRDGAGKYFL--W------VVKFNSLNELVDYH---------------------
38 PsiBlast_CBE 67.8831%-156 - C3 - - 1A81 KSYK_HUMAN A:[160-236] --------------WFHGKISREESEQIVLIGSKTN-GKFLIRARDNN--GSYALCLLHEGKVLHYRIDKDKTGKLSIP-E------GKKFDTLWQLVEHY---------------------
36 PsiBlast_CBE 67.6131%-150 - C3 - - 1A81 KSYK_HUMAN E:[160-236] --------------WFHGKISREESEQIVLIGSKTN-GKFLIRARDNN--GSYALCLLHEGKVLHYRIDKDKTGKLSIP-E------GKKFDTLWQLVEHY---------------------
35 PsiBlast_CBE 67.5731%-160 - C3 - - 1A81 KSYK_HUMAN G:[160-236] --------------WFHGKISREESEQIVLIGSKTN-GKFLIRARDNN--GSYALCLLHEGKVLHYRIDKDKTGKLSIP-E------GKKFDTLWQLVEHY---------------------
173 HHSearch 67.3426%-190 - C3 - - 2GSB - A:[18-93] --------------WFHGKISKQEAYNLLMTVG--QVCSFLVRPSDNT-PGDYSLYFRTNENIQRFKICPTPNNQFMM--G------GRYYNSIGDIIDHY---------------------
189 Fugue 56.7633% 36 - C3 - - 1CSZ A:[1-112] GSRRASVGSHEKMPWFHGKISREESEQIVLIGSKTN-GKFLIRARDN-N-GSYALCLLHEGKVLHYRIDKDKTGKLSIPEG-------KKFDTLWQLVEHYSYKADGLLRVLTVPCQKIGTQ