@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : SRC_HUMAN: (2017-06-04 )
WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYY

Atome Classification :

(89 SA) ---.........10........20........30........40........50........60-.......---.70........80..-----------------
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
32 PsiBlast_CBE 92.19100%-136 - C1 - - 1HCT B:[9-91] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
33 PsiBlast_CBE 91.95100%-159 - C1 - - 1HCS B:[9-91] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
4 PsiBlast_PDB 89.76100%-145 - C1 - - 1KSW - SRC_HUMAN A:[67-149] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
271 HHSearch 89.06100%-161 - C1 - - 2H8H - SRC_HUMAN A:[150-232] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
1 PsiBlast_PDB 89.06100%-161 - C1 - - 2H8H - SRC_HUMAN A:[150-232] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
29 PsiBlast_CBE 88.01100%-141 - C1 - - 1O4J A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
10 PsiBlast_PDB 87.93100%-139 - C1 - - 1O44 A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
30 PsiBlast_CBE 87.88100%-149 - C1 - - 1O4I A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
3 PsiBlast_PDB 87.77100%-149 - C1 - - 2SRC - SRC_HUMAN A:[67-149] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
26 PsiBlast_CBE 87.69100%-143 - C1 - - 1O4M A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
21 PsiBlast_CBE 87.62100%-147 - C1 - - 1O4R A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
54 PsiBlast_CBE 87.5397%-142 - C1 - - 1SHB A:[5-87] ---WYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFSSLQQLVAYY-----------------
28 PsiBlast_CBE 87.45100%-149 - C1 - - 1O4K A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
6 PsiBlast_PDB 86.92100%-149 - C1 - - 4K11 - SRC_HUMAN A:[65-147] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
57 PsiBlast_CBE 86.8797%-153 - C1 - - 1NZV B:[4-86] ---WYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFSSLQQLVAYY-----------------
27 PsiBlast_CBE 86.81100%-143 - C1 - - 1O4L A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
19 PsiBlast_PDB 86.78100%-144 - C1 - - 1O4E A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
41 PsiBlast_CBE 86.77100%-148 - C1 - - 1A09 SRC_HUMAN A:[9-91] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
31 PsiBlast_CBE 86.56100%-166 - C1 - - 1SHD A:[9-91] ---WYFGKITRRESERLLLNAENPRGTFLVRESE----AYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
55 PsiBlast_CBE 86.5597%-145 - C1 - - 1SHA A:[5-87] ---WYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFSSLQQLVAYY-----------------
23 PsiBlast_CBE 86.54100%-134 - C1 - - 1O4P A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
48 PsiBlast_CBE 86.4897%-145 - C1 - - 1IS0 B:[5-87] ---WYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFSSLQQLVAYY-----------------
20 PsiBlast_PDB 86.43100%-144 - C1 - - 1O4H A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
17 PsiBlast_PDB 86.41100%-126 - C1 - - 1O4B A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
18 PsiBlast_PDB 86.37100%-139 - C1 - - 1O4D A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
62 PsiBlast_CBE 86.3697%-157 - C1 - - 1P13 SRC_CHICK A:[4-86] ---WYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFSSLQQLVAYY-----------------
45 PsiBlast_CBE 86.28100%-144 - C1 - - 1A07 SRC_HUMAN A:[9-91] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
52 PsiBlast_CBE 86.2097%-133 - C1 - - 1SPS SRC_RSVSA A:[5-87] ---WYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFSSLQQLVAYY-----------------
14 PsiBlast_PDB 86.17100%-134 - C1 - - 1O48 A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
7 PsiBlast_PDB 86.08100%-143 - C1 - - 1O41 A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
35 PsiBlast_CBE 85.82100%-152 - C1 - - 1A1E SRC_HUMAN A:[9-91] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
25 PsiBlast_CBE 85.69100%-142 - C1 - - 1O4N A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
69 PsiBlast_CBE 85.5498%-146 - C1 - - 1O4F A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
49 PsiBlast_CBE 85.4997%-151 - C1 - - 1IS0 SRC_RSVSA A:[5-87] ---WYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFSSLQQLVAYY-----------------
43 PsiBlast_CBE 85.49100%-137 - C1 - - 1A08 SRC_HUMAN A:[9-91] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
44 PsiBlast_CBE 85.47100%-134 - C1 - - 1A07 B:[9-91] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
8 PsiBlast_PDB 85.44100%-131 - C1 - - 1O42 A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
65 PsiBlast_CBE 85.4396%-140 - C1 - - 1F1W A:[5-87] ---WYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIW---SRTQFSSLQQLVAYY-----------------
12 PsiBlast_PDB 85.29100%-136 - C1 - - 1O46 A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
16 PsiBlast_PDB 85.28100%-132 - C1 - - 1O4A A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
22 PsiBlast_CBE 85.27100%-147 - C1 - - 1O4Q A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
51 PsiBlast_CBE 85.2197%-153 - C1 - - 1SPS SRC_RSVSA B:[5-87] ---WYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFSSLQQLVAYY-----------------
68 PsiBlast_CBE 85.0998%-139 - C1 - - 1O4G A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
11 PsiBlast_PDB 84.98100%-143 - C1 - - 1O45 A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
59 PsiBlast_CBE 84.9197%-150 - C1 - - 1NZL B:[4-86] ---WYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFSSLQQLVAYY-----------------
24 PsiBlast_CBE 84.89100%-134 - C1 - - 1O4O A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
40 PsiBlast_CBE 84.82100%-143 - C1 - - 1A09 B:[9-91] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
39 PsiBlast_CBE 84.78100%-137 - C1 - - 1A1B SRC_HUMAN A:[9-91] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
42 PsiBlast_CBE 84.66100%-143 - C1 - - 1A08 B:[9-91] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
13 PsiBlast_PDB 84.63100%-130 - C1 - - 1O47 A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
9 PsiBlast_PDB 84.62100%-135 - C1 - - 1O43 A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
71 PsiBlast_CBE 84.2393%-159 - C1 - - 1KC2 A:[4-86] ---WYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVS-------LNVAHYKIRKLD-SGGFYIT---SRTQFSSLQQLVAYY-----------------
46 PsiBlast_CBE 84.2398%-125 - C1 - - 1A1A B:[9-91] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYSLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
15 PsiBlast_PDB 83.94100%-132 - C1 - - 1O49 A:[7-89] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
37 PsiBlast_CBE 83.42100%-132 - C1 - - 1A1C SRC_HUMAN A:[9-91] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
36 PsiBlast_CBE 83.25100%-142 - C1 - - 1A1C B:[9-91] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
63 PsiBlast_CBE 83.2296%-150 - C1 - - 1BKM A:[6-88] ---WYFGKITRRESEALLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFSSLQQLVAYY-----------------
61 PsiBlast_CBE 83.2197%-153 - C1 - - 1P13 B:[4-86] ---WYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFSSLQQLVAYY-----------------
47 PsiBlast_CBE 82.6198%-132 - C1 - - 1A1A SRC_HUMAN A:[9-91] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYSLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
38 PsiBlast_CBE 82.54100%-143 - C1 - - 1A1B B:[9-91] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
34 PsiBlast_CBE 82.42100%-136 - C1 - - 1A1E B:[9-91] ---WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFNSLQQLVAYY-----------------
50 PsiBlast_CBE 82.3897%-136 - C1 - - 1SPS C:[5-87] ---WYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFSSLQQLVAYY-----------------
56 PsiBlast_CBE 82.0297%-153 - C1 - - 1SKJ A:[6-88] ---WYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFSSLQQLVAYY-----------------
285 Fugue 71.8897% 52 * C1 * - 1SHB A:[2-104] AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLD-SGGFYIT---SRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT
72 PsiBlast_CBE 71.8468%-110 - C1 - - 1AOU F:[7-89] ---WYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLD-NGGYYIT---TRAQFETLQQLVQHY-----------------
114 PsiBlast_CBE 71.1654%-150 - C1 - - 1IJR LCK_HUMAN A:[5-87] ---WFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFCLSVRDFDQNQGEVVKHYKIRNLD-NGGFYIS---PRITFPGLHELVRHY-----------------
121 PsiBlast_CBE 68.4253%-145 - C1 - - 1X27 ? D:[68-150] ---WFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLD-NGGFYIS---PRITFPGLHELVRHY-----------------
73 PsiBlast_CBE 68.3368% -99 - C1 - - 1AOT F:[7-89] ---WYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLD-NGGYYIT---TRAQFETLQQLVQHY-----------------
116 PsiBlast_CBE 66.7254%-151 - C1 - - 1FBZ LCK_HUMAN A:[5-87] ---WFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFCLSVRDFDQNQGEVVKHYKIRNLD-NGGFYIS---PRITFPGLHELVRHY-----------------
120 PsiBlast_CBE 66.1953%-123 - C1 - - 1X27 ? E:[68-150] ---WFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLD-NGGFYIS---PRITFPGLHELVRHY-----------------
122 PsiBlast_CBE 65.9953%-139 - C1 - - 1X27 ? C:[68-150] ---WFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLD-NGGFYIS---PRITFPGLHELVRHY-----------------
123 PsiBlast_CBE 65.2653%-119 - C1 - - 1X27 ? B:[68-150] ---WFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLD-NGGFYIS---PRITFPGLHELVRHY-----------------
128 PsiBlast_CBE 64.3853%-124 - C1 - - 1LKL ? A:[5-87] ---WFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLD-NGGFYIS---PRITFPGLHELVRHY-----------------
124 PsiBlast_CBE 64.0253%-134 - C1 - - 1X27 A:[68-150] ---WFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLD-NGGFYIS---PRITFPGLHELVRHY-----------------
273 HHSearch 64.0053%-127 - C1 - - 4D8K A:[76-158] ---WFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLD-NGGFYIS---PRITFPGLHELVRHY-----------------
118 PsiBlast_CBE 64.0053%-127 - C1 - - 4D8K A:[76-158] ---WFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLD-NGGFYIS---PRITFPGLHELVRHY-----------------
119 PsiBlast_CBE 63.8253%-132 - C1 - - 1X27 ? F:[68-150] ---WFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLD-NGGFYIS---PRITFPGLHELVRHY-----------------
125 PsiBlast_CBE 63.7453%-140 - C1 - - 1LCJ LCK_HUMAN A:[10-92] ---WFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLD-NGGFYIS---PRITFPGLHELVRHY-----------------
270 HHSearch 63.4553%-128 - C1 - - 1LKK LCK_HUMAN A:[6-88] ---WFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLD-NGGFYIS---PRITFPGLHELVRHY-----------------
127 PsiBlast_CBE 63.4553%-128 - C1 - - 1LKK LCK_HUMAN A:[6-88] ---WFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLD-NGGFYIS---PRITFPGLHELVRHY-----------------
115 PsiBlast_CBE 63.3854%-155 - C1 - - 1FBZ ? B:[5-87] ---WFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFCLSVRDFDQNQGEVVKHYKIRNLD-NGGFYIS---PRITFPGLHELVRHY-----------------
126 PsiBlast_CBE 62.8953%-134 - C1 - - 1BHF A:[9-91] ---WFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLD-NGGFYIS---PRITFPGLHELVRHY-----------------
117 PsiBlast_CBE 62.4453%-130 - C1 - - 1LCK LCK_HUMAN A:[76-158] ---WFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLD-NGGFYIS---PRITFPGLHELVRHY-----------------
130 PsiBlast_CBE 61.9453%-144 - C1 - - 1CWE ? A:[3-85] ---WFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLD-NGGFYIS---PRITFPGLHELVRHY-----------------
131 PsiBlast_CBE 61.7853%-136 - C1 - - 1CWD ? L:[3-85] ---WFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLD-NGGFYIS---PRITFPGLHELVRHY-----------------
129 PsiBlast_CBE 61.3453%-151 - C1 - - 1CWE ? C:[3-85] ---WFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLD-NGGFYIS---PRITFPGLHELVRHY-----------------
276 HHSearch 56.1938%-107 - C1 - - 3PQZ GRB7_HUMAN A:[16-97] ---WFHGRISREESQRLIGQQGLVDGLFLVRESQR-PQGFVLSLCH-----LQKVKHYLILPSEEEGRLYFSMDDGQTRFTDLLQLVEFH-----------------
75 PsiBlast_CBE 52.5668% -65 - C1 - - 4U17 ? C:[6-88] ---WYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLD-NGGYYIT---TRAQFETLQQLVQHY-----------------
77 PsiBlast_CBE 49.7768% -65 - C1 - - 4U17 FYN_HUMAN A:[6-88] ---WYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLD-NGGYYIT---TRAQFETLQQLVQHY-----------------