@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : spr0025: (2017-12-13 )
MEEVEVAEVKNARVSLTGEKTKPMKLAEVTSINVNRTKTEMEEFNRVLGGGVVPGSLVLIGGDPGIGKSTLLLQVSTQLSQVGTVLYVSGEESAQQIKLRAERLGDIDSEFYLYAETNMQSVRAEVERIQPDFLIIDSIQTIMSPEISGVQGSVSQVREVTAELMQLAKTNNIAIFIVGHVTKEGTLAGPRMLEHMVDTVLYFEGERHHTFRILRAVKNRFGSTNEIGIFEMQSGGLVEVLNPSQVFLEERLDGATGSSIVVTMEGTRPILAEVQALVTPTMFGNAKRTTTGLDFNRASLIMAVLEKRAGLLLQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDKPTNPQECFVGELGLTGEIRRVNRIEQRINEAAKLGFTKIYVPKNSLTGITLPKEIQVIGVTTIQEVLKKVFA

Atome Classification :

(20 SA) .........10........20........30........40........50........60........70........80------..-......90...--.....100.....----..110.......120-----.........130.......140.......150-.........160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......-290.--......300.........310.......320...---.....330.......340.......350.......360.......370.......380.......390.....-..400----.......410.......420
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) MEEVEVAEVKNARVSLTGEKTKPMKLAEVTSINVNRTKTEMEEFNRVLGGGVVPGSLVLIGGDPGIGKSTLLLQVSTQLSQ------VG-TVLYVSGEESA--QQIKLRAERLGDI----DSEFYLYAETNMQ-------SVRAEVERIQPDFLIIDSIQTIMSPEISGV---QGSVSQVREVTAELMQLAKTNNIAIFIVGHVTKEGTLAGPRMLEHMVDTVLYFEGERHHTFRILRAVKNRFGSTNEIGIFEMQSGGLVEVLNPSQVFLEERLDGATGSSIVVTMEGTRPILAEVQALVTPTMFGNAKRT-TTGL--DFNRASL--IMAVLEKRAGLLLQNQDAYLK-SAG---GVKLDEPAIDLAVAVAIASSYKDKPTNPQECFVGELGLTGEIRRVNRIEQRINEAAKLGFTKIYVPKNSLTGI-TLPKE----IQVIGVTTIQEVLKKVFA
1 PsiBlast_PDB 94.7999%-124 * C1 * - 5LKM ? A:[53-452] -------------------KTKPMKLAEVTSINVNRTKTEMEEFNRVLGGGVVPGSLVLIGGDPGIGKSTLLLQVSTQLSQ------VG-TVLYVSGEESA--QQIKLRAERLGDI----DSEFYLYAETNMQ-------SVRAEVERIQPDFLIIDSIQTIMSPE---------SVSQVREVTAELMQLAKTNNIAIFIVGHVTKE----GPRMLEHMVDTVLYFEGERHHTFRILRAVKNRFGSTNEIGIFEMQSGGLVEVLNPSQVFLEERLDGATGSSIVVTMEGTRPILAEVQALVTPTMFGNAKRT-TTGL--DFNRASL--IMAVLEKRAGLLLQNQDAYLK-SAG---GVKLDEPAIDLAVAVAIASSYKDKPTNPQECFVGELGLTGEIRRVNRIEQRINEAAKLGFTKIYVPKNSLTGI-TLPKE----IQVIGVTTIQEVLKKVF-
31 HHSearch 94.66100%-124 - C1 - - 5LKM ? A:[55-452] ---------------------KPMKLAEVTSINVNRTKTEMEEFNRVLGGGVVPGSLVLIGGDPGIGKSTLLLQVSTQLSQ------VG-TVLYVSGEESA--QQIKLRAERLGDI----DSEFYLYAETNMQ-------SVRAEVERIQPDFLIIDSIQTIMSPE---------SVSQVREVTAELMQLAKTNNIAIFIVGHVTKE----GPRMLEHMVDTVLYFEGERHHTFRILRAVKNRFGSTNEIGIFEMQSGGLVEVLNPSQVFLEERLDGATGSSIVVTMEGTRPILAEVQALVTPTMFGNAKRT-TTGL--DFNRASL--IMAVLEKRAGLLLQNQDAYLK-SAG---GVKLDEPAIDLAVAVAIASSYKDKPTNPQECFVGELGLTGEIRRVNRIEQRINEAAKLGFTKIYVPKNSLTGI-TLPKE----IQVIGVTTIQEVLKKVF-
30 HHSearch 92.65100%-127 - C1 - - 5LKM ? C:[66-452] --------------------------------NVNRTKTEMEEFNRVLGGGVVPGSLVLIGGDPGIGKSTLLLQVSTQLSQ------VG-TVLYVSGEESA--QQIKLRAERLGDI----DSEFYLYAETNMQ-------SVRAEVERIQPDFLIIDSIQTIMSP----------SVSQVREVTAELMQLAKTNNIAIFIVGHVT-------PRMLEHMVDTVLYFEGERHHTFRILRAVKNRFGSTNEIGIFEMQSGGLVEVLNPSQVFLEERLDGATGSSIVVTMEGTRPILAEVQALVTPTMFGNAKRT-TTGL--DFNRASL--IMAVLEKRAGLLLQNQDAYLK-SAG---GVKLDEPAIDLAVAVAIASSYKDKPTNPQECFVGELGLTGEIRRVNRIEQRINEAAKLGFTKIYVPKNSLTGI-TLPKE----IQVIGVTTIQEVLKKVF-
21 PsiBlast_CBE 92.4599%-127 - C1 - - 5LKM ? C:[66-452] --------------------------------NVNRTKTEMEEFNRVLGGGVVPGSLVLIGGDPGIGKSTLLLQVSTQLSQ------VG-TVLYVSGEESA--QQIKLRAERLGDI----DSEFYLYAETNMQ-------SVRAEVERIQPDFLIIDSIQTIMSP----------SVSQVREVTAELMQLAKTNNIAIFIVGHVT-------PRMLEHMVDTVLYFEGERHHTFRILRAVKNRFGSTNEIGIFEMQSGGLVEVLNPSQVFLEERLDGATGSSIVVTMEGTRPILAEVQALVTPTMFGNAKRT-TTGL--DFNRASL--IMAVLEKRAGLLLQNQDAYLK-SAG---GVKLDEPAIDLAVAVAIASSYKDKPTNPQECFVGELGLTGEIRRVNRIEQRINEAAKLGFTKIYVPKNSLTGI-TLPKE----IQVIGVTTIQEVLKKVF-
22 PsiBlast_CBE 92.1399%-142 - C1 - - 5LKM ? B:[54-452] --------------------TKPMKLAEVT----NRTKTEMEEFNRVLGGGVVPGSLVLIGGDPGIGKSTLLLQVSTQL-------------LYVSGEESA--QQIKLRAERL--------SEFYL----NMQ-------SVRAEVERIQPDFLIIDSIQ--------------GSVSQVREVTAELMQLAKTNNIAIFIVGHV-------------------LYFEG-----FRILRAVKNRFGSTNEIGIFEMQSGGLVEVLNPSQVFLEERLDGATGSSIVVTMEGTRPILAEVQALVTPTMFGNAKRT-TTGL--DFNRASL--IMAVLEKRAGLLLQNQDAYLK-SAG---GVKLDEPAIDLAVAVAIASSYKDKPTNPQECFVGELGLTGEIRRVNRIEQRINEAAKLGFTKIYVPKNSLTGI-TLPKE----IQVIGVTTIQEVLKKVF-
2 PsiBlast_PDB 64.26100%-133 - C1 - - 5LKQ - ? A:[23-198] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SQVFLEERLDGATGSSIVVTMEGTRPILAEVQALVTPTMFGNAKRT-TTGL--DFNRASL--IMAVLEKRAGLLLQNQDAYLK-SAG---GVKLDEPAIDLAVAVAIASSYKDKPTNPQECFVGELGLTGEIRRVNRIEQRINEAAKLGFTKIYVPKNSLTGI-TLPKE----IQVIGVTTIQEVLKKVF-
33 HHSearch 63.6994%-133 - C1 - - 5LKQ - ? A:[23-198] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SQVFLEERLDGATGSSIVVTMEGTRPILAEVQALVTPTMFGNAKRT-TTGL--DFNRASL--IMAVLEKRAGLLLQNQDAYLK-SAG---GVKLDEPAIDLAVAVAIASSYKDKPTNPQECFVGELGLTGEIRRVNRIEQRINEAAKLGFTKIYVPKNSLTGI-TLPKE----IQVIGVTTIQEVLKKVF-
32 HHSearch 63.0994%-132 - C1 - - 5LKQ - ? B:[22-198] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GSQVFLEERLDGATGSSIVVTMEGTRPILAEVQALVTPTMFGNAKRT-TTGL--DFNRASL--IMAVLEKRAGLLLQNQDAYLK-SAG---GVKLDEPAIDLAVAVAIASSYKDKPTNPQECFVGELGLTGEIRRVNRIEQRINEAAKLGFTKIYVPKNSLTGI-TLPKE----IQVIGVTTIQEVLKKVF-
35 HHSearch 52.7840%-129 - C1 - - 5H45 - ? A:[33-175] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GVPGSAVALALAGERALALEVQALAAKTPFPAPRRV-VQGL--DGRRVDV--VLAVLERRLGLPLANLDVYVN-LAG---GLKVQDPGLDLAVALAVYSAVVGRPLPADLALVGEVGLAGEVRRVAGLERRLREGERAGFGRFLHPGNLKRL-----------------------------
34 HHSearch 52.4040%-123 - C1 - - 5H45 - ? B:[28-175] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------KERPLGVPGSAVALALAGERALALEVQALAAKTPFPAPRRV-VQGL--DGRRVDV--VLAVLERRLGLPLANLDVYVN-LAG---GLKVQDPGLDLAVALAVYSAVVGRPLPADLALVGEVGLAGEVRRVAGLERRLREGERAGFGRFLHPGNLKRL-----------------------------
3 PsiBlast_PDB 51.9242%-129 - C1 - - 5H45 - ? A:[33-171] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GVPGSAVALALAGERALALEVQALAAKTPFPAPRRV-VQGL--DGRRVDV--VLAVLERRLGLPLANLDVYVN-LAG---GLKVQDPGLDLAVALAVYSAVVGRPLPADLALVGEVGLAGEVRRVAGLERRLREGERAGFGRFLHPGN---------------------------------
11 PsiBlast_PDB 35.9826% -36 - C1 - - 1XHK - LONB_METJA A:[77-184] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LNNKEIYIQFSQS---YSKIDGDSATAAVCLAIISALLDIPLKQDFAITGSLDLSGNVLAIGGVNEKIEAAKRYGFKRVIIPEANMIDV-IETEG----IEIIPVKTLDEIVPLVF-
14 PsiBlast_PDB 35.1828% -76 - C1 - - 4YPM ? A:[180-260] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------G---ATPKDGPSAGITMATAIASALSRRPARMDIAMTGEVSLRGKVMPIGGVKEKLLAAHQAGIHKIVLPKDNEAQLEELPKE----V-----------------
17 PsiBlast_PDB 34.5527%-134 - C1 - - 5G4F - VAT_THEAC A:[220-317] --------------------------------------------------GITPPKGVILYGPPGTGKTLIARAVANESG--------A-NFLSINGPE----------------I----MSKYYGQSEQKLR-------EIFSKAEETAPSIIFIDEIDSI-APKREEV---QGEVE--RRVVAQLLTL---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
13 PsiBlast_PDB 34.4128% -77 - C1 - - 5E7S - ? A:[670-750] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------G---ATPKDGPSAGITMATAIASALSRRPARMDIAMTGEVSLRGKVMPIGGVKEKLLAAHQAGIHKIVLPKDNEAQLEELPKE----V-----------------
5 PsiBlast_PDB 34.1730% 15 - C1 - - 1Z0G - LONB_ARCFU A:[444-600] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PIIAEV----TPSM---EGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQ-FVGTYEGVEGDSASI--SIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDV-LLDAEHEGKIEVIPVSRINEVLEHVL-
49 HHSearch 34.0418% -25 - C1 - - 3LDA - RAD51_YEAST A:[156-396] --------------------------------ELICLTTGSKNLDTLLGGGVETGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDTEGTFRPVRLVSIAQRFGLDPDDALNNVAYARAYNADHQLRLLDAAAQMMSESRFSLIVVDSVMALYR------GELSARQMHLAKFMRALQRLADQFGVAVVVTNQV---------NIMAYSSTTRLGFKKGKG-CQRLCKVVDSPCLP-EAECVFAIYEDGVGDPR-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
7 PsiBlast_PDB 33.9530% 10 - C1 - - 1Z0V - LONB_ARCFU A:[444-600] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PIIAEV----TPSM---EGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQ-FVGTYEGVEGDSASI--SIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDV-LLDAEHEGKIEVIPVSRINEVLEHVL-
6 PsiBlast_PDB 33.5130% 14 - C1 - - 1Z0T - LONB_ARCFU A:[444-600] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PIIAEV----TPSM---EGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQ-FVGTYEGVEGDSASI--SIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDV-LLDAEHEGKIEVIPVSRINEVLEHVL-
4 PsiBlast_PDB 32.9030% 13 - C1 - - 1Z0E - LONB_ARCFU A:[444-600] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PIIAEV----TPSM---EGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQ-FVGTYEGVEGDSASI--SIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDV-LLDAEHEGKIEVIPVSRINEVLEHVL-