@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : spr0031: (2017-12-14 )
MILRHLGISPTNDLVAKKIFSNPEITCQFIRDMLDLPAKNVTILEGSDIHVLLSMPYSVQDFYTSIDVLAELDNGTQVIIEIQVHHQNFFINHLWAYLCSQVNQNLEKIHQREGDTH

Atome Classification :

(20 SA) ---------------........-.------10-..----..--....20.--------.......30...-.....---40....---.--...------50------......-.-.60...---.---.-------...70.-....-...80---..-----...-------....90.........100-.......110..-...--------------
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) ---------------MILRHLGI-S------PT-ND----LV--AKKIFSN--------PEITCQFIRDML-DLPAK---NVTILE---G--SDI------HV------LLSMPY-S-VQDFYT---S---I-------DVLAEL-DNGT-QVII----EI-----QVH-------HQNFF-INHLWAYLCSQV-NQNLEKIHQREG-DTH--------------
32 Fugue 66.4217% -19 - C3 - - 5ICA - ? A:[1-163] ---TKQTVETLMAGERIAEALEL-G------MT-DL----NT--IREWEEARQINPNIAPPQRNPIFVALG-NIPAE---TYVLNT---L--QKIKPASLHDA------LLVLPF-STIPSLLT---F---L-------NLFAQR-ELNV-PLTC----RILFFVLKTH-------HKQIV-ASRTMRATLEKV-RANLRAALRRQK-DEMGFNIAALKVVSMQL
35 Fugue 57.8720% 28 - C3 - - 5EUR - ? A:[2-128] --------------SISYRKLDI-A------LS-ADKETVLV--FGQELST--------KYFTEIVVTTML-NSTGS---DMANSN---RILNDI------HAAG----LDAGDY-G-KYSRWW---A---Q-------SNAQER-QEAE-RRRK----EA-----KAH-------QERM-----------AAI-HAREEALIKRFG------------------
36 Fugue 55.9913% 5 * C3 * - 2KPO - ? A:[1-110] ---------------MLLYVLII-S------ND-KK----LIEEARKMAEK--------ANLELRTVKTED-ELKKY---LEEFRK---E--SQN------IK------VLILVS-N-DEELDK---A---K-------ELAQKM-EIDV-RTRK----VT-----SPD-------EAKRW-IKEFSEE------GGSLEHHHHHH-------------------
11 PsiBlast_PDB 50.7840%-181 - C6 - - 2JLL A:[116-155] ------------------------N------PI-N------I--SCDVKSN--------PPASIHWRRDKL-VLPAK---NTTNLK-------------------------------------------------------------------------------------------------------------------------------------------
30 Fugue 50.1213% -77 - C3 - - 2LQO - Y3198_MYCTU A:[1-88] ---------------MVTA-------------------------ALTIYTT--------S--WCGYCLRLK-TALTA---NRIAYD---E--VDI------------------------EHNRA---A---A-------EFVGSV-NGGN-RTVP----TV-----KFA-------DGSTL-TN-------PSA-DEVKAKLVKIAGLEHH--------------
22 HHSearch 49.1021%-253 - C4 - - 4CII - ? A:[73-96] ------------------------F------IS-ED----VI--FKTYMSS--------PELLLTYMKI------------------------------------------------------------------------------------------------------------------------------------------------------------
1 PsiBlast_PDB 48.3525% -88 - C2 - - 2HPW - ? A:[45-117] -------------------------------------------------------------IKAKYICTTG-DLPVP---WATILS---S--L-V------FC------FAKYPR-H-IADFFK---S---TQPDGYSQDRIISF-DNDG-QYDV----KA-----KVT-------YEN----------------------------------------------
3 PsiBlast_PDB 47.4234% - - C4 - - 4F6C - ? A:[2179-2221] ----------------------------------------------------------------------F-DIDTE---DVTFSE------ADV------YKGQ----LLTSPY-T-RSKFYS---E---L-------KVLEAV-NNG----------------------------------------------------------------------------
38 Fugue 47.117% 22 * C5 * - 2M89 - ? A:[1-134] -------------MVNINHRIGI-K------AS-PE----KI--YQALTTD--------DGLKKWWTNDISGAGVVG---STIKFRFNGG--GPD------FK------VTKLIP-N-KTVCWQ---H---A-------GNMPES-WMGT-EISF----QL-----ETVEN-----QTFVR-FTHSNWHETTDF-MAHCNTKWAVFL-LSLKDALEIGKG-----
31 Fugue 46.2917% 40 - C5 - - 2WGO - ? A:[-1-96] ----------------------S-L------IL-DG----DL--LKDKLKL--------PVIDNLFGKELL-DKFQD---DIKDKY---G--VDT------KD------LKILKT-S-EDKRFY---Y---V-------SVDA---GDGE-KCKF----KI-----R----------KDVD-VPKMVGRKCRK---------DDDDD-DGY--------------
14 PsiBlast_PDB 46.1831% 9 - C4 - - 4WDB CN37_MOUSE A:[136-182] ----------------------------------------------------------------------L-DKPSA---SEGLPP---G--SQA------HV------TLGCAA-D-VQPVQT---GLDLL-------DILQQV-KGGS-Q-------------------------------------------------------------------------
4 PsiBlast_PDB 45.8048%-114 * C6 * - 2XYC A:[124-150] -----------------------------------------------VKSN--------PPASIHWRRDKL-VLPAK---NTTNLK-------------------------------------------------------------------------------------------------------------------------------------------
33 Fugue 45.5613% 46 - C3 - - 2ES9 - ? A:[11-110] -----------TAIEKALDFIGGMNTSASVPHSMDE----ST--AKGILKY--------LHD--------L-GVPVS---PEVVVA---R--GEQ------E-----------GW-N-PEFTKK---V---A-------GWAEKV-ASGN-RILI----K----------------NPEYF----------STYMQEQLKELVLEH-------------------
2 PsiBlast_PDB 45.2634% - - C4 - - 4F6L - ? B:[2179-2221] ----------------------------------------------------------------------F-DIDTE---DVTFSE------ADV------YKGQ----LLTSPY-T-RSKFYS---E---L-------KVLEAV-NNG----------------------------------------------------------------------------
8 PsiBlast_PDB 45.0738% 86 - C4 - - 2VYE - ? A:[127-190] -----------------------------------------------------------------------------------------------------------------------QDGYTREDE---I-------DVL--L-DEAE-RKIM----EVS----QRK-------HSGAF-KN--IKDVLVQT-YDNIEMLHNRNG-D----------------
34 Fugue 44.9511% 29 - C5 - - 3NQN ? A:[4-158] LSAEQSFTLRHPHGQAAALAFVR-E------PA-AA----LA--GVRFLRG--------LDSDGEQVWGEL-LVTVPLLGEVDLPF---R--SEI------VRTPQGAELRPLTL-T-GERAWV---A---V-------SGQATAAEGGEMAFAF----QF-----QAHLAEGWGGAAFEKMVQAAAGRTLERV-AKALPEGLAAGL-PPA--------------
16 PsiBlast_PDB 42.6429%-148 - C4 - - 4K6N PABC_YEAST A:[112-159] -------------------------------------------------------------IVCQRVEDML-QVIYE---RFFLLD---E--QYQ------RI------RIALSY-F-KIDFST---S---L-------NDLLKL--------------------------------------------------------------------------------
37 Fugue 42.4616% -87 - C3 - - 1CZ5 - VAT_THEAC A:[96-185] ------------------KKVTL-A------PI-IR-----K--DQRLKFG--------EGIEE-YVQRAL---I-----RRPMLE---Q--DNI------SV------P-GLTL-A-GQ-TGL---L---F-------KVVKTL-PSKV-PVEIGEETKI-----EIR-------EE-------------PAS------EVLEEGG------------------
12 PsiBlast_PDB 42.1931% -63 - C4 - - 3R5L DDN_MYCTU A:[65-112] -------------------------------------------------AN--------PKVQVQIKKEVL-DLTAR---DATDEE---R--AEY------WP------QLVTMYPS-YQDYQS---W---T-------D-------------------------------------------------------------------------------------
26 HHSearch 41.869%-101 - C4 - - 2G7J - ? A:[96-112] ------------------------------------------------FSS--------RIALERYLNGLF-GD-------------------------------------------------------------------------------------------------------------------------------------------------------