@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : B0VKA8: (2017-10-25 )
MSTTSSATTPIEINALGQPCPMPLLMLKRELKKLSGKQLFLLKSSDPHSEIDVTRYCQLHHFTCQTMQISEREFHYLIETQ

Atome Classification :

(20 SA) ----------------.........10.......--.20........30...--.------.-.-..40.....--------...50.--.......60.........----70.........80-
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) ----------------MSTTSSATTPIEINALGQ--PCPMPLLMLKRELKKL--S------G-K-QLFLLKSSD--------PHSEID--VTRYCQLH-HFTCQTMQI----S-EREFHYLIETQ-
17 HHSearch 76.0421%-124 - C5 - - 3LVJ - TUSA_ECO57 C:[5-81] --------------------LFSSPDHTLDALGL--RCPEPVMMVRKTVRNM--Q------P-G-ETLLIIADD--------PATTRD--IPGFCTFM-EHELVAKET----D-GLPYRYLIRKG-
38 Fugue 73.9120%-115 - C5 - - 1DCJ - TUSA_ECOLI A:[1-81] -----------------MTDLFSSPDHTLDALGL--RCPEPVMMVRKTVRNM--Q------P-G-ETLLIIADD--------PATTRD--IPGFCTFM-EHELVAKET----D-GLPYRYLIRKGG
19 HHSearch 70.6219%-115 - C5 - - 1DCJ - TUSA_ECOLI A:[3-80] -------------------DLFSSPDHTLDALGL--RCPEPVMMVRKTVRNM--Q------P-G-ETLLIIADD--------PATTRD--IPGFCTFM-EHELVAKET----D-GLPYRYLIRKG-
18 HHSearch 70.0219% -76 - C5 - - 1JE3 - YEDF_ECOLI A:[21-97] -------------------MKNIVPDYRLDMVGE--PCPYPAVATLEAMPQL--K------K-G-EILEVVSDC--------PQSINN--IPLDARNH-GYTVLDIQQ----D-GPTIRYLIQK--
1 PsiBlast_PDB 67.1822%-181 - C5 - - 3LVJ - TUSA_ECO57 C:[13-78] ----------------------------LDALGL--RCPEPVMMVRKTVRNM--Q------P-G-ETLLIIADD--------PATTRD--IPGFCTFM-EHELVAKET----D-GLPYRYLI----
21 HHSearch 66.2120% -26 * C5 * - 3HZ7 ? A:[2-73] --------------------------ITIDALGQ--VCPIPVIRAKKALAEL--GE-----A-G-GVVTVLVDN--------DISRQN--LQKMAEGM-GYQSEYLEK----D-NGVIEVTIVAG-
3 PsiBlast_PDB 64.8422%-170 - C5 - - 1DCJ - TUSA_ECOLI A:[12-77] ----------------------------LDALGL--RCPEPVMMVRKTVRNM--Q------P-G-ETLLIIADD--------PATTRD--IPGFCTFM-EHELVAKET----D-GLPYRYLI----
5 PsiBlast_PDB 64.5822%-100 - C5 - - 1JE3 - YEDF_ECOLI A:[30-96] ----------------------------LDMVGE--PCPYPAVATLEAMPQL--K------K-G-EILEVVSDC--------PQSINN--IPLDARNH-GYTVLDIQQ----D-GPTIRYLIQ---
2 PsiBlast_PDB 64.1022%-176 - C5 - - 3LVK - TUSA_ECO57 B:[13-78] ----------------------------LDALGL--RCPEPVMMVRKTVRNM--Q------P-G-ETLLIIADD--------PATTRD--IPGFCTFM-EHELVAKET----D-GLPYRYLI----
26 HHSearch 64.0820% -47 - C5 - - 3FAU - D:[10-89] ---------------------------SLDLHGL--HVDEALEHLMRVLEKK--TEEFKQNGGK-PYLSVITGRGSQGGV--ARIKPA--VIKYLISH-SFRFSE--I----K-PGCLKVML----
25 HHSearch 63.9620% -90 - C5 - - 3FAU - N4BP2_HUMAN B:[10-89] ---------------------------SLDLHGL--HVDEALEHLMRVLEKK--TEEFKQNGGK-PYLSVITGRGNHSQGGVARIKPA--VIKYLISH-SFRFSE--I----K-PGCLKVML----
6 PsiBlast_PDB 62.3139%-249 - C2 - - 3BZ5 - INLJ_LISMO A:[216-253] -------------------------------------------------------------------FLDCSSN--------KLTEID--VTPLTQLT-YFDCSVNPL----T-ELDVSTL-----
4 PsiBlast_PDB 61.7239%-112 - C5 - - 3HZ7 ? A:[2-39] --------------------------ITIDALGQ--VCPIPVIRAKKALAELGEA------G-G-VVTVLVDND----------------------------------------------------
39 Fugue 59.4820% 25 - C5 - - 1DCJ - TUSA_ECOLI A:[1-81] --------------MT---DLFSSPDHTLDALGL--RCPEPVMMVRKTVRNM--Q------P-G-ETLLIIADD--------PATTRD--IPGFCTFMEHELVAKETD----G--LPYRYLIRKGG
46 Fugue 59.2325% 7 - C4 - - 4BZ2 ? A:[1-101] VEFKRMCSGKFSIDKEMAETQHGTTVVKVKYEGAGAPCKVPIEIRDVNKEKV--V------G-R-II----SST--------PFAEYTNSVTNIELEP-PFGDSYIVIGVGDS-ALTLHWFRKHH-
24 HHSearch 57.2716% -53 - C5 - - 2D9I - A:[4-91] ---------------------GSSGQNVLDLHGL--HVDEALEHLMRVLEKK--TEEFKQNG-GKPYLSVITGRGNHSQGGVARIKPA--VIKYLISH-SFRFSE--I----K-PGCLKVMLKS--
20 HHSearch 51.7017% -74 - C5 - - 1PAV - Y1170_THEAC A:[3-77] ----------------------VKPDRVIDARGS--YCPGPLMELIKAYKQA--K------V-G-EVISVYSTD--------AGTKKD--APAWIQKS-GQELVGVFD----R-NGYYEIVMKKV-
22 HHSearch 51.4114% -38 - C5 - - 1JDQ - Y983_THEMA A:[19-98] ------------------HMAKYQVTKTLDVRGE--VCPVPDVETKRALQNM--K------P-G-EILEVWIDY--------PMSKER--IPETVKKL-GHEVLEIEE----VGPSEWKIYIKVK-
35 HHSearch 48.8720%-262 - C5 - - 1FD8 - ATX1_YEAST A:[6-30] -------------------------HYQFNV-VM--TCSGCSGAVNKVLTKL--E-----------------------------------------------------------------------
36 HHSearch 47.3020%-270 - C5 - - 1CC8 ATX1_YEAST A:[6-30] -------------------------HYQFNV-VM--TCSGCSGAVNKVLTKL--E-----------------------------------------------------------------------