@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : B0VTG7: (2017-12-13 )
MKRVVITGMGINSCIGNSLEEVTHSLKNGISGTRFNPTYAELNFKSHVSAAAEQDFDNIDRKLKRFMGVCAMYAYNSAVAAVEHAGLKAEDLADNPRYGIAGGSGGGSTASVVEMTELLETKGARKVGPFFVPRNMTNTITANVGVAFKLQGIAHSIASACATSADAIGYAYNLIALGKQDLMLAGGGEEDHWSQSLLFDAMGALCSKYNDTPETASRPYSKDRDGFVIAGGGGFVVLESLEHAQARGANILAEVVAYAANSDGADMVAPSGEGATRCILMALEEAKQHGVDKIDYVNTHGTSTPAGDVTELKAMERAFGEGKVPPLSSTKSMTGHSLGAAGVHEAIYSVLMLQNDFIAPNINVTELDEGTEGFDIVLEKRDTKLNTVMSNSFGFGGVNACLIFKKWDA

Atome Classification :

(36 SA) .........10........20........30.--.......40.--.......50.------...--.---..-.60........70-------.........80-------.........90..----......100.......110.......120.........130.......140.......150.......160.......170.......180.......190......-.200.......210.......220.......230.......240.......250.......260.......--270-...--.....280.......290-.--.......300.......310.......320.-..-.---..-..330.......340.......350.......360.......-370....------..-.380.-..-.....390.......400.......
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) MKRVVITGMGINSCIGNSLEEVTHSLKNGISG--TRFNPTYAEL--NFKSHVSAAA------EQD--F---DN-IDRKLKRFMGVC--------AMYAYNSAVA--------AVEHAGLKAEDLA----DNPRYGIAGGSGGGSTASVVEMTELLE--TKGARKVGPFFVPRNMTNTITANVGVAFKLQGIAHSIASACATSADAIGYAYNLIALGKQDLMLAGGGEEDHWSQSLL-FDAMGALCSKYNDTPETASRPYSKDRDGFVIAGGGGFVVLESLEHAQARGANILAEVVAYAANSDGADMVA--PS--GEG--ATRCILMALEEAKQHGV--D--KIDYVNTHGTSTPAGDVTELKAMERAFGE-G-KV-P---PL-SSTKSMTGHSLGAAGVHEAIYSVLMLQNDFIAPNINVTELDE-GTEGFDI------VL-EK-RD-TK-LNTVMSNSFGFGGVNACLIFKKWDA
70 PsiBlast_CBE 94.6855% -17 - C1 - - 1EK4 FABB_ECOLI B:[13-415] MKRVVITGLGIVSSIGNNQQEVLASLREGRSG--ITFSQELKDS--GMRSHVWGNV------KLD--T---TGLIDRKVVRFMSDA--------SIYAFLSMEQ--------AIADAGLSPEAYQ----NNPRVGLIAGSGGGSPRFQVFGADAMRG-PRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSASATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVA--PS--GEG--AVRCMKMAM-----HGV--DT-PIDYLNSHGTSTPVGDVKELAAIREVFGD---KS-P---AI-SATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDE-QAAGLNI------VT-ET-TD-RE-LTTVMSNSFGFGGTNATLVMRK---
43 PsiBlast_CBE 94.1855% -21 - C1 - - 2BYX FABB_ECOLI C:[13-415] MKRVVITGLGIVSSIGNNQQEVLASLREGRSG--ITFSQELKDS--GMRSHVWGNV------KLD--T---TGLIDRKVVRFMSDA--------SIYAFLSMEQ--------AIADAGLSPEAYQ----NNPRVGLIAGSGGGSPRFQVFGADAMRG-PRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVA--PS--GEG--AVRCMKMAM-----HGV--DT-PIDYLNSHGTSTPVGDVKELAAIREVFGD---KS-P---AI-SATAAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDE-QAAGLNI------VT-ET-TD-RE-LTTVMSNSFGFGGTNATLVMRK---
159 HHSearch 94.0055% -21 * C1 * - 2VBA FABB_ECOLI A:[1-404] MKRAVITGLGIVSSIGNNQQEVLASLREGRSG--ITFSQELKDS--GMRSHVWGNV------KLDT-T---GL-IDRKVVRFMSDA--------SIYAFLSMEQ--------AIADAGLSPEAYQ----NNPRVGLIAGSGGGSPRF-QVFGADAMRGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVA--PS--GEG--AVRCMKMAMHGV---D---T--PIDYLNSHGTSTPVGDVKELAAIREVFGD---KS-P---AI-SATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDE-QAAGLNI------VT-ET-TD-RE-LTTVMSNSFGFGGTNATLVMRKL--
69 PsiBlast_CBE 94.0055% -18 - C1 - - 1EK4 FABB_ECOLI C:[13-415] MKRVVITGLGIVSSIGNNQQEVLASLREGRSG--ITFSQELKDS--GMRSHVWGNV------KLD--T---TGLIDRKVVRFMSDA--------SIYAFLSMEQ--------AIADAGLSPEAYQ----NNPRVGLIAGSGGGSPRFQVFGADAMRG-PRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSASATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVA--PS--GEG--AVRCMKMAM-----HGV--DT-PIDYLNSHGTSTPVGDVKELAAIREVFGD---KS-P---AI-SATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDE-QAAGLNI------VT-ET-TD-RE-LTTVMSNSFGFGGTNATLVMRK---
68 PsiBlast_CBE 94.0055% -17 - C1 - - 1EK4 FABB_ECOLI D:[13-415] MKRVVITGLGIVSSIGNNQQEVLASLREGRSG--ITFSQELKDS--GMRSHVWGNV------KLD--T---TGLIDRKVVRFMSDA--------SIYAFLSMEQ--------AIADAGLSPEAYQ----NNPRVGLIAGSGGGSPRFQVFGADAMRG-PRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSASATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVA--PS--GEG--AVRCMKMAM-----HGV--DT-PIDYLNSHGTSTPVGDVKELAAIREVFGD---KS-P---AI-SATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDE-QAAGLNI------VT-ET-TD-RE-LTTVMSNSFGFGGTNATLVMRK---
19 PsiBlast_PDB 93.8655% -17 - C1 - - 2BZ4 - FABB_ECOLI A:[13-415] MKRAVITGLGIVSSIGNNQQEVLASLREGRSG--ITFSQELKDS--GMRSHVWGNV------KLD--T---TGLIDRKVVRFMSDA--------SIYAFLSMEQ--------AIADAGLSPEAYQ----NNPRVGLIAGSGGGSPRFQVFGADAMRG-PRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVA--PS--GEG--AVRCMKMAM-----HGV--DT-PIDYLNSQGTSTPVGDVKELAAIREVFGD---KS-P---AI-SATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDE-QAAGLNI------VT-ET-TD-RE-LTTVMSNSFGFGGTNATLVMRK---
15 PsiBlast_PDB 93.7655% -19 - C1 - - 2BYW - FABB_ECOLI A:[13-415] MKRVVITGLGIVSSIGNNQQEVLASLREGRSG--ITFSQELKDS--GMRSHVWGNV------KLD--T---TGLIDRKVVRFMSDA--------SIYAFLSMEQ--------AIADAGLSPEAYQ----NNPRVGLIAGSGGGSPRFQVFGADAMRG-PRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVA--PS--GEG--AVRCMKMAM-----HGV--DT-PIDYLNSHGTSTPVGDVKELAAIREVFGD---KS-P---AI-SATAAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDE-QAAGLNI------VT-ET-TD-RE-LTTVMSNSFGFGGTNATLVMRK---
10 PsiBlast_PDB 93.7455% -18 - C1 - - 2AQB FABB_ECOLI A:[1-403] MKRAVITGLGIVSSIGNNQQEVLASLREGRSG--ITFSQELKDS--GMRSHVWGNV------KLD--T---TGLIDRKVVRFMSDA--------SIYAFLSMEQ--------AIADAGLSPEAYQ----NNPRVGLIAGSGGGSPRFQVFGADAMRG-PRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVA--PS--GEG--AVRCMKMAM-----HGV--DT-PIDYLNSHGTSTPVGDVKELAAIREVFGD---KS-P---AI-SATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDE-QAAGLNI------VT-ET-TD-RE-LTTVMSNSFGFGGTNATLVMRK---
42 PsiBlast_CBE 93.7255% -22 - C1 - - 2BYX FABB_ECOLI D:[13-415] MKRVVITGLGIVSSIGNNQQEVLASLREGRSG--ITFSQELKDS--GMRSHVWGNV------KLD--T---TGLIDRKVVRFMSDA--------SIYAFLSMEQ--------AIADAGLSPEAYQ----NNPRVGLIAGSGGGSPRFQVFGADAMRG-PRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVA--PS--GEG--AVRCMKMAM-----HGV--DT-PIDYLNSHGTSTPVGDVKELAAIREVFGD---KS-P---AI-SATAAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDE-QAAGLNI------VT-ET-TD-RE-LTTVMSNSFGFGGTNATLVMRK---
35 PsiBlast_CBE 93.6655% -17 - C1 - - 2AQ7 FABB_ECOLI B:[2-403] -KRAVITGLGIVSSIGNNQQEVLASLREGRSG--ITFSQELKDS--GMRSHVWGNV------KLD--T---TGLIDRKVVRFMSDA--------SIYAFLSMEQ--------AIADAGLSPEAYQ----NNPRVGLIAGSGGGSPRFQVFGADAMRG-PRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVA--PS--GEG--AVRCMKMAM-----HGV--DT-PIDYLNSHGTSTPVGDVKELAAIREVFGD---KS-P---AI-SATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDE-QAAGLNI------VT-ET-TD-RE-LTTVMSNSFGFGGTNATLVMRK---
16 PsiBlast_PDB 93.4555% -21 - C1 - - 2BYX FABB_ECOLI A:[13-415] MKRVVITGLGIVSSIGNNQQEVLASLREGRSG--ITFSQELKDS--GMRSHVWGNV------KLD--T---TGLIDRKVVRFMSDA--------SIYAFLSMEQ--------AIADAGLSPEAYQ----NNPRVGLIAGSGGGSPRFQVFGADAMRG-PRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVA--PS--GEG--AVRCMKMAM-----HGV--DT-PIDYLNSHGTSTPVGDVKELAAIREVFGD---KS-P---AI-SATAAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDE-QAAGLNI------VT-ET-TD-RE-LTTVMSNSFGFGGTNATLVMRK---
74 PsiBlast_CBE 93.4455% -17 - C1 - - 1F91 FABB_ECOLI B:[1-403] MKRVVITGLGIVSSIGNNQQEVLASLREGRSG--ITFSQELKDS--GMRSHVWGNV------KLD--T---TGLIDRKVVRFMSDA--------SIYAFLSMEQ--------AIADAGLSPEAYQ----NNPRVGLIAGSGGGSPRFQVFGADAMRG-PRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSASATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVA--PS--GEG--AVRCMKMAM-----HGV--DT-PIDYLNSHGTSTPVGDVKELAAIREVFGD---KS-P---AI-SATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDE-QAAGLNI------VT-ET-TD-RE-LTTVMSNSFGFGGTNATLVMRK---
54 PsiBlast_CBE 93.4055% -18 - C1 - - 2BYZ FABB_ECOLI D:[13-415] MKRAVITGLGIVSSIGNNQQEVLASLREGRSG--ITFSQELKDS--GMRSHVWGNV------KLD--T---TGLIDRKVVRFMSDA--------SIYAFLSMEQ--------AIADAGLSPEAYQ----NNPRVGLIAGSGGGSPRFQVFGADAMRG-PRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVA--PS--GEG--AVRCMKMAM-----HGV--DT-PIDYLNSQGTSTPVGDVKELAAIREVFGD---KS-P---AI-SATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDE-QAAGLNI------VT-ET-TD-RE-LTTVMSNSFGFGGTNATLVMRK---
34 PsiBlast_CBE 93.3355% -19 - C1 - - 2AQ7 FABB_ECOLI D:[2-403] -KRAVITGLGIVSSIGNNQQEVLASLREGRSG--ITFSQELKDS--GMRSHVWGNV------KLD--T---TGLIDRKVVRFMSDA--------SIYAFLSMEQ--------AIADAGLSPEAYQ----NNPRVGLIAGSGGGSPRFQVFGADAMRG-PRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVA--PS--GEG--AVRCMKMAM-----HGV--DT-PIDYLNSHGTSTPVGDVKELAAIREVFGD---KS-P---AI-SATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDE-QAAGLNI------VT-ET-TD-RE-LTTVMSNSFGFGGTNATLVMRK---
44 PsiBlast_CBE 93.2655% -21 - C1 - - 2BYX FABB_ECOLI B:[13-415] MKRVVITGLGIVSSIGNNQQEVLASLREGRSG--ITFSQELKDS--GMRSHVWGNV------KLD--T---TGLIDRKVVRFMSDA--------SIYAFLSMEQ--------AIADAGLSPEAYQ----NNPRVGLIAGSGGGSPRFQVFGADAMRG-PRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVA--PS--GEG--AVRCMKMAM-----HGV--DT-PIDYLNSHGTSTPVGDVKELAAIREVFGD---KS-P---AI-SATAAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDE-QAAGLNI------VT-ET-TD-RE-LTTVMSNSFGFGGTNATLVMRK---
14 PsiBlast_PDB 93.2155% -18 - C1 - - 2VBA FABB_ECOLI A:[1-403] MKRAVITGLGIVSSIGNNQQEVLASLREGRSG--ITFSQELKDS--GMRSHVWGNV------KLD--T---TGLIDRKVVRFMSDA--------SIYAFLSMEQ--------AIADAGLSPEAYQ----NNPRVGLIAGSGGGSPRFQVFGADAMRG-PRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVA--PS--GEG--AVRCMKMAM-----HGV--DT-PIDYLNSHGTSTPVGDVKELAAIREVFGD---KS-P---AI-SATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDE-QAAGLNI------VT-ET-TD-RE-LTTVMSNSFGFGGTNATLVMRK---
8 PsiBlast_PDB 93.1355% -17 - C1 - - 2BUI FABB_ECOLI A:[1-403] MKRAVITGLGIVSSIGNNQQEVLASLREGRSG--ITFSQELKDS--GMRSHVWGNV------KLD--T---TGLIDRKVVRFMSDA--------SIYAFLSMEQ--------AIADAGLSPEAYQ----NNPRVGLIAGSGGGSPRFQVFGADAMRG-PRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVA--PS--GEG--AVRCMKMAM-----HGV--DT-PIDYLNSHGTSTPVGDVKELAAIREVFGD---KS-P---AI-SATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDE-QAAGLNI------VT-ET-TD-RE-LTTVMSNSFGFGGTNATLVMRK---
57 PsiBlast_CBE 93.0755% -18 - C1 - - 2BZ3 FABB_ECOLI D:[13-415] MKRAVITGLGIVSSIGNNQQEVLASLREGRSG--ITFSQELKDS--GMRSHVWGNV------KLD--T---TGLIDRKVVRFMSDA--------SIYAFLSMEQ--------AIADAGLSPEAYQ----NNPRVGLIAGSGGGSPRFQVFGADAMRG-PRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVA--PS--GEG--AVRCMKMAM-----HGV--DT-PIDYLNSEGTSTPVGDVKELAAIREVFGD---KS-P---AI-SATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDE-QAAGLNI------VT-ET-TD-RE-LTTVMSNSFGFGGTNATLVMRK---
38 PsiBlast_CBE 92.9055% -21 - C1 - - 1FJ8 FABB_ECOLI B:[2-403] -KRAVITGLGIVSSIGNNQQEVLASLREGRSG--ITFSQELKDS--GMRSHVWGNV------KLD--T---TGLIDRKVVRFMSDA--------SIYAFLSMEQ--------AIADAGLSPEAYQ----NNPRVGLIAGSGGGSPRFQVFGADAMRG-PRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVA--PS--GEG--AVRCMKMAM-----HGV--DT-PIDYLNSHGTSTPVGDVKELAAIREVFGD---KS-P---AI-SATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDE-QAAGLNI------VT-ET-TD-RE-LTTVMSNSFGFGGTNATLVMRK---
11 PsiBlast_PDB 92.8655% -16 - C1 - - 2VB7 - FABB_ECOLI A:[1-403] MKRAVITGLGIVSSIGNNQQEVLASLREGRSG--ITFSQELKDS--GMRSHVWGNV------KLD--T---TGLIDRKVVRFMSDA--------SIYAFLSMEQ--------AIADAGLSPEAYQ----NNPRVGLIAGSGGGSPRFQVFGADAMRG-PRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACE-FDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVA--PS--GEG--AVRCMKMAM-----HGV--DT-PIDYLNSHGTSTPVGDVKELAAIREVFGD---KS-P---AI-SATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDE-QAAGLNI------VT-ET-TD-RE-LTTVMSNSFGFGGTNATLVMRK---
65 PsiBlast_CBE 89.3852% -21 - C1 - - 3MQD ? A:[22-426] MRRVVVTGMGIVSSIGSNTEEVTASLREAKSG--ISRAEEYAEL--GFRCQVHGAP------DID--I---ESLVDRRAMRFHGRG--------TAWNHIAMDQ--------AIADAGLTEEEVS-----NERTGIIMGSGGPSTRTIVDSADITR--EKGPKRVGPFAVPKAMSSTASATLATFFKIKGINYSISSACATSNHCIGNAYEMIQYGKQDRMFAGGCEDLDWTLSVL-FDAMGAMSSKYNDTPSTASRAYDKNRDGFVIAGGAGVLVLEDLETALARGAKIYGEIVGYGATSDGYDMVA--PS--GEG--AIRCMKMALSTV----T--S--KIDYINPHATSTPAGDAPEIEAIRQIFGA-G-DVCP---PI-AATKSLTGHSLGATGVQEAIYSLLMMQNNFICESAHIEELDP-AFADMPI------VR-KR-IDNVQ-LNTVLSNSFGFGGTNATLVFQRY--
67 PsiBlast_CBE 89.3552% -20 - C1 - - 3U0F ? A:[5-409] MRRVVVTGMGIVSSIGSNTEEVTASLREAKSG--ISRAEEYAEL--GFRCQVHGAP------DID--I---ESLVDRRAMRFHGRG--------TAWNHIAMDQ--------AIADAGLTEEEVS-----NERTGIIMGSGGPSTRTIVDSADITR--EKGPKRVGPFAVPKAMSSTASATLATFFKIKGINYSISSACATSNHCIGNAYEMIQYGKQDRMFAGGCEDLDWTLSVL-FDAMGAMSSKYNDTPSTASRAYDKNRDGFVIAGGAGVLVLEDLETALARGAKIYGEIVGYGATSDGYDMVA--PS--GEG--AIRCMKMALSTV----T--S--KIDYINPHATSTPAGDAPEIEAIRQIFGA-G-DVCP---PI-AATKSLTGHSLGATGVQEAIYSLLMMQNNFICESAHIEELDP-AFADMPI------VR-KR-IDNVQ-LNTVLSNSFGFGGTNATLVFQRY--
151 HHSearch 85.6553% -6 - C1 - - 3MQD ? A:[22-427] MRRVVVTGMGIVSSIGSNTEEVTASLREAKSG--ISRAEEYAEL--GFRCQVHG-A------PDIDIE---SL-VDRRAMRFHGRG--------TAWNHIAMDQ--------AIADAGLTEEEV-----SNERTGIIMGSGGPSTRTIVDSADITR--EKGPKRVGPFAVPKAMSSTASATLATFFKIKGINYSISSACATSNHCIGNAYEMIQYGKQDRMFAGGCEDLDWTLSVL-FDAMGAMSSKYNDTPSTASRAYDKNRDGFVIAGGAGVLVLEDLETALARGAKIYGEIVGYGATSDGYDMVA--PS--GEG--AIRCMKMALSTV----T--S--KIDYINPHATSTPAGDAPEIEAIRQIFGA-GDVC-P---PI-AATKSLTGHSLGATGVQEAIYSLLMMQNNFICESAHIEELDP-AFADMPI------VR-KRIDN-VQ-LNTVLSNSFGFGGTNATLVFQRYQ-
155 HHSearch 85.4253% -6 - C1 - - 3U0F ? A:[5-410] MRRVVVTGMGIVSSIGSNTEEVTASLREAKSG--ISRAEEYAEL--GFRCQV-HGA------PDIDIE---SL-VDRRAMRFHGRG--------TAWNHIAMDQ--------AIADAGLTEEEV-----SNERTGIIMGSGGPSTRTIVDSADITR--EKGPKRVGPFAVPKAMSSTASATLATFFKIKGINYSISSACATSNHCIGNAYEMIQYGKQDRMFAGGCEDLDWTLSVL-FDAMGAMSSKYNDTPSTASRAYDKNRDGFVIAGGAGVLVLEDLETALARGAKIYGEIVGYGATSDGYDMVA--PS--GEG--AIRCMKMALSTV----T--S--KIDYINPHATSTPAGDAPEIEAIRQIFGA-GDVC-P---PI-AATKSLTGHSLGATGVQEAIYSLLMMQNNFICESAHIEELDP-AFADMPI------VR-KRIDN-VQ-LNTVLSNSFGFGGTNATLVFQRYQ-
112 PsiBlast_CBE 72.9039% -1 - C1 - - 3HO9 FABF_ECOLI A:[18-426] -RRVVVTGLGMLSPVGNTVESTWKALLAGQSG--ISLIDHFDTS--AYATKF-AGL------VKD--FNCEDI-ISRKEQRKMDAF--------IQYGIVAGVQ--------AMQDSGLEITE-E----NATRIGAAIGSGIGGLGLIEENHTSLM--NGGPRKISPFFVPSTIVNMVAGHLTIMYGLRGPSISIATAATSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGGFGAARALSTR-NDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKKRGAKIYAELVGFGMSSDAYHMTS--PP---EN--GAGAALAMANALRDAGI--EASQIGYVNAHGTSTPAGDKAEAQAVKTIFGE-A-AS-R---VLVSSTKSMTGHLLGAAGAVESIYSILALRDQAVPPTINLDNPDE-GCDLDFV------PH-EA-RQ-VSGMEYTLCNSFGFGGTNGSLIFKK---
114 PsiBlast_CBE 72.8039% -2 - C1 - - 3HNZ FABF_ECOLI A:[18-426] -RRVVVTGLGMLSPVGNTVESTWKALLAGQSG--ISLIDHFDTS--AYATKF-AGL------VKD--FNCEDI-ISRKEQRKMDAF--------IQYGIVAGVQ--------AMQDSGLEITE-E----NATRIGAAIGSGIGGLGLIEENHTSLM--NGGPRKISPFFVPSTIVNMVAGHLTIMYGLRGPSISIATAATSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGGFGAARALSTR-NDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKKRGAKIYAELVGFGMSSDAYHMTS--PP---EN--GAGAALAMANALRDAGI--EASQIGYVNAHGTSTPAGDKAEAQAVKTIFGE-A-AS-R---VLVSSTKSMTGHLLGAAGAVESIYSILALRDQAVPPTINLDNPDE-GCDLDFV------PH-EA-RQ-VSGMEYTLCNSFGFGGTNGSLIFKK---
111 PsiBlast_CBE 72.5839% -2 - C1 - - 3I8P FABF_ECOLI A:[18-426] -RRVVVTGLGMLSPVGNTVESTWKALLAGQSG--ISLIDHFDTS--AYATKF-AGL------VKD--FNCEDI-ISRKEQRKMDAF--------IQYGIVAGVQ--------AMQDSGLEITE-E----NATRIGAAIGSGIGGLGLIEENHTSLM--NGGPRKISPFFVPSTIVNMVAGHLTIMYGLRGPSISIATAATSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGGFGAARALSTR-NDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKKRGAKIYAELVGFGMSSDAYHMTS--PP---EN--GAGAALAMANALRDAGI--EASQIGYVNAHGTSTPAGDKAEAQAVKTIFGE-A-AS-R---VLVSSTKSMTGHLLGAAGAVESIYSILALRDQAVPPTINLDNPDE-GCDLDFV------PH-EA-RQ-VSGMEYTLCNSFGFGGTNGSLIFKK---
113 PsiBlast_CBE 72.2639% -3 - C1 - - 3HO2 FABF_ECOLI A:[18-426] -RRVVVTGLGMLSPVGNTVESTWKALLAGQSG--ISLIDHFDTS--AYATKF-AGL------VKD--FNCEDI-ISRKEQRKMDAF--------IQYGIVAGVQ--------AMQDSGLEITE-E----NATRIGAAIGSGIGGLGLIEENHTSLM--NGGPRKISPFFVPSTIVNMVAGHLTIMYGLRGPSISIATAATSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGGFGAARALSTR-NDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKKRGAKIYAELVGFGMSSDAYHMTS--PP---EN--GAGAALAMANALRDAGI--EASQIGYVNAHGTSTPAGDKAEAQAVKTIFGE-A-AS-R---VLVSSTKSMTGHLLGAAGAVESIYSILALRDQAVPPTINLDNPDE-GCDLDFV------PH-EA-RQ-VSGMEYTLCNSFGFGGTNGSLIFKK---
115 PsiBlast_CBE 72.2439% -0 - C1 - - 3G11 FABF_ECOLI A:[18-426] -RRVVVTGLGMLSPVGNTVESTWKALLAGQSG--ISLIDHFDTS--AYATKF-AGL------VKD--FNCEDI-ISRKEQRKMDAF--------IQYGIVAGVQ--------AMQDSGLEITE-E----NATRIGAAIGSGIGGLGLIEENHTSLM--NGGPRKISPFFVPSTIVNMVAGHLTIMYGLRGPSISIATAQTSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGGFGAARALSTR-NDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKKRGAKIYAELVGFGMSSDAYHMTS--PP---EN--GAGAALAMANALRDAGI--EASQIGYVNAHGTSTPAGDKAEAQAVKTIFGE-A-AS-R---VLVSSTKSMTGHLLGAAGAVESIYSILALRDQAVPPTINLDNPDE-GCDLDFV------PH-EA-RQ-VSGMEYTLCNSFGFGGTNGSLIFKK---
117 PsiBlast_CBE 70.5939% 0 - C1 - - 2GFX FABF_ECOLI A:[18-426] -RRVVVTGLGMLSPVGNTVESTWKALLAGQSG--ISLIDHFDTS--AYATKF-AGL------VKD--FNCEDI-ISRKEQRKMDAF--------IQYGIVAGVQ--------AMQDSGLEITE-E----NATRIGAAIGSGIGGLGLIEENHTSLM--NGGPRKISPFFVPSTIVNMVAGHLTIMYGLRGPSISIATAQTSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGGFGAARALSTR-NDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKKRGAKIYAELVGFGMSSDAYHMTS--PP---EN--GAGAALAMANALRDAGI--EASQIGYVNAHGTSTPAGDKAEAQAVKTIFGE-A-AS-R---VLVSSTKSMTGHLLGAAGAVESIYSILALRDQAVPPTINLDNPDE-GCDLDFV------PH-EA-RQ-VSGMEYTLCNSFGFGGTNGSLIFKK---
116 PsiBlast_CBE 69.6039% 2 - C1 - - 3G0Y FABF_ECOLI A:[18-426] -RRVVVTGLGMLSPVGNTVESTWKALLAGQSG--ISLIDHFDTS--AYATKF-AGL------VKD--FNCEDI-ISRKEQRKMDAF--------IQYGIVAGVQ--------AMQDSGLEITE-E----NATRIGAAIGSGIGGLGLIEENHTSLM--NGGPRKISPFFVPSTIVNMVAGHLTIMYGLRGPSISIATAQTSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGGFGAARALSTR-NDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKKRGAKIYAELVGFGMSSDAYHMTS--PP---EN--GAGAALAMANALRDAGI--EASQIGYVNAHGTSTPAGDKAEAQAVKTIFGE-A-AS-R---VLVSSTKSMTGHLLGAAGAVESIYSILALRDQAVPPTINLDNPDE-GCDLDFV------PH-EA-RQ-VSGMEYTLCNSFGFGGTNGSLIFKK---
128 PsiBlast_CBE 67.3735% 5 - C1 - - 2IWZ OXSM_HUMAN A:[21-433] -RRVVITGIGLVTPLGVGTHLVWDRLIGGESGIVSLVGEEYKSIPCSVAAYVPRGSDEGQFNEQN--F------VSKSDIKSMSSP--------TIMAIGAAEL--------AMKDSGWHPQSEA----DQVATGVAIGMGMIPLEVVSETALNFQ--TKGYNKVSPFFVPKILVNMAAGQVSIRYKLKGPNHAVSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSLAGFSRARALST--NSDPKLACRPFHPKRDGFVMGEGAAVLVLEEYEHAVQRRARIYAEVLGYGLSGDAGHITAPDPE--GEG--ALRCMAAALKDAGVQ-P--E--EISYINAHATSTPLGDAAENKAIKHLFKDHA-YA-L---AV-SSTKGATGHLLGAAGAVEAAFTTLACYYQKLPPTLN---LDC-SEPEFDLNYVPLKAQ-EW-KT-EK-RFIGLTNSFGFGGTNATL-------
124 PsiBlast_CBE 60.4836% 12 - C1 - - 2IX4 KASM_ARATH A:[1-428] -RRVVVTGLGMVTPLGRGVETTWRRLIDGECG--IR-GLTLDDL--KMKSFDEETK------LYT--F---DQ-LSSKVAAFVPYGSNPGEFDEALWLNSKAVANFIGYAVCAADEALRDAEWLPTEEEEKERTGVSIGGGIGSICDIVEAAQLIC--EKRLRRLSPFFIPKILVNMASGHVSMKYGFQGPNHAAVTACATGAHSIGDATRMIQFGDADVMVAGGTESSIDALSVAGFSRSRALSTKFNSSPQEASRPFDCDRDGFVIGEGSGVIVLEEYEHAKRRGAKIYAELCGYGMSGDAHHITQ--PPEDGKG--AVLAMTRAL---RQSGLCPN--QIDYVNAHATSTPIGDAVEARAIKTVFSE-H-AT-SGTLAF-SSTKGATGHLLGAAGAVEAIFSILAIHHGVAPMTLNVKNPDPIFDKRFMP------LT-TS-KK-ML-VRTAMSNSFGFGGTNASLLF-----
123 PsiBlast_CBE 60.3436% 14 - C1 - - 2IX4 KASM_ARATH B:[1-428] -RRVVVTGLGMVTPLGRGVETTWRRLIDGECG--IR-GLTLDDL--KMKSFDEETK------LYT--F---DQ-LSSKVAAFVPYGSNPGEFDEALWLNSKAVANFIGYAVCAADEALRDAEWLPTEEEEKERTGVSIGGGIGSICDIVEAAQLIC--EKRLRRLSPFFIPKILVNMASGHVSMKYGFQGPNHAAVTACATGAHSIGDATRMIQFGDADVMVAGGTESSIDALSVAGFSRSRALSTKFNSSPQEASRPFDCDRDGFVIGEGSGVIVLEEYEHAKRRGAKIYAELCGYGMSGDAHHITQ--PPEDGKG--AVLAMTRAL---RQSGLCPN--QIDYVNAHATSTPIGDAVEARAIKTVFSE-H-AT-SGTLAF-SSTKGATGHLLGAAGAVEAIFSILAIHHGVAPMTLNVKNPDPIFDKRFMP------LT-TS-KK-ML-VRTAMSNSFGFGGTNASLLF-----
135 PsiBlast_CBE 53.3736% -26 - C1 - - 2WGE FAB1_MYCTU A:[104-416] ---------------------------------------------------------------------------------------------------------------------------------DPDRFAVVVGTGLGGAERIVESYDLMN--AGGPRKVSPLAVQMIMPNGAAAVIGLQLGARAGVMT