@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : I3U031: (2017-12-17 )
MMELQFPLHNDTSRKIIHIDMDAFFASVEERDHPEFRGHPLVIARHPSDTGGRGVVTTANYEARKFGIHSAMSAQKAYELCPQAIFKPGDHHKYSDISKQVREVFYRYTDIVEPVSIDEAYLDVTENKINCKSAIKIARMIQADIWESVQLTCSAGVSYNKFLAKLASDYQKPRGITVVAPQDAVPFLKALPIEKFHGVGKKTVPRMHELGIYTGKDLYECTEMMLIRNFGKMGYSLYRKVRGIHDSPVNVTRERKSVGKEHTYGQPLQTEEAVLTQLRQLAEKVEEALRRVQKHGKTVVLKVRYTDYSTVTKRVTLPEYIYKKEALFYQASLIWEEILGVEKGIRLLGITLTNLDPMTYENIVLPLWENQEI

Atome Classification :

(29 SA) -------------------------------------------------------.........10........20........30........40........50.----.......60........70........80........90........100.......110.......120.......--130.--------------------.......140.......150.......160.......170.......180-........190.......200.......210.......220.......230-.-......240.......250.......260......---.270......-----.280.......290.--......300.......310.......320.......330.......----340..----......350.......360.......370.
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) -------------------------------------------------------MMELQFPLHNDTSRKIIHIDMDAFFASVEERDHPEFRGHPLVIARHPSDTGG----RGVVTTANYEARKFGIHSAMSAQKAYELCPQAIFKPGDHHKYSDISKQVREVFYRYTDIVEPVSIDEAYLDVTENKI--NC-K--------------------SAIKIARMIQADIWESVQLTCSAGVSYNKFLAKLASDYQKPRGITVVAP--QDAVPFLKALPIEKFHGVGKKTVPRMHELGIYTGKDLYECTEMMLIRNFGK-M-GYSLYRKVRGIHDSPVNVTRERKSVGKEHTYGQPL---QTEEAVLTQL-----RQLAEKVEEALRRVQ--KHGKTVVLKVRYTDYSTVTKRVTLPEYIYKKEALFYQASLIWEEIL----G-VEK----GIRLLGITLTNLDPMTYENIVLPLWENQEI
34 HHSearch 83.2841% -98 - C1 - - 4IRD DPO4_ECOLI A:[2-342] -------------------------------------------------------------------SRKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSR---ER----RGVISTANYPARKFGVRSAMPTGMALALCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVH--CH-G--------------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQACDLVMLLKRFGK-F-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDI---HHWSECEAII-----ERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQEHVW--PRLNKADLIATARKTWDERR------GGR----GVRLVGLHVTLLDP----------------
37 HHSearch 79.4040% -93 - C1 - - 5C5J ? A:[2-342] -------------------------------------------------------------------SRKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSR---ER----RGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVH--CH-G--------------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGK-F-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDI---HHWSECEAII-----ERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQEHVW--PRLNKADLIATARKTWDERR------GGR----GVRLVGLHVTLLDP----------------
39 HHSearch 70.5628% -83 - C1 - - 4TQR DPO4_SULSO A:[1-342] --------------------------------------------------------------------MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFED----SGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVR--DY-R--------------------EAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKPNGIKVIDD--EEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAK-AKYLISLARDEYNEPIRT-RVRKSIGRIVTMKRNS---RNLEEIKPYL-----FRAIEESYYKLDKRI----PKAIHVVAVTEDLDIVSRGRTFPHGIS-KETAYSESVKLLQKIL----EEDER----KIRRIGVRFSKFIE----------------
38 HHSearch 70.3328% -85 - C1 - - 3RAX DPO4_SULSO B:[1-341] --------------------------------------------------------------------GIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFED----SGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVR--DY-R--------------------EAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKPNGIKVIDD--EEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAK-AKYLISLARDEYNEPIRT-RVRKSIGRIVTMKRNS---RNLEEIKPYL-----FRAIEESYYKLDKRI----PKAIHVVAVTEDLDIVSRGRTFPHGIS-KETAYSESVKLLQKIL----EEDER----KIRRIGVRFSKFI-----------------
30 PsiBlast_CBE 68.5540% -25 - C1 - - 4R8U ? B:[1-336] --------------------------------------------------------------------RKIIHVDMDCFFAAVEMRDNPALRDIPIAIG---GSRER----RGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDS-V--HCHG--------------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGK-F-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLL--IA--RQG----VKLKFDDFQQTTQEHVWPR--LNKADLIATARKTWDERR----G--GR----GVRLVGLHVT--------------------
22 PsiBlast_CBE 68.4240% -20 - C1 - - 4Q43 DPO4_ECOLI F:[2-342] -------------------------------------------------------------------SRKIIHVDMDCFFAAVEMRDNPALRDIPIAIG---GSRER----RGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDS-V--HCHG--------------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGK-F-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLL--IA--RQG----VKLKFDDFQQTTQEHVWPR--LNKADLIATARKTWDERR----G--GR----GVRLVGLHVTLLDP----------------
1 PsiBlast_PDB 68.3240% -20 - C1 - - 4IR1 DPO4_ECOLI F:[2-342] -------------------------------------------------------------------SRKIIHVDMDCFFAAVEMRDNPALRDIPIAIG---GSRER----RGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDS-V--HCHG--------------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGK-F-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLL--IA--RQG----VKLKFDDFQQTTQEHVWPR--LNKADLIATARKTWDERR----G--GR----GVRLVGLHVTLLDP----------------
21 PsiBlast_CBE 67.8540% -18 - C1 - - 5C5J ? A:[2-342] -------------------------------------------------------------------SRKIIHVDMDCFFAAVEMRDNPALRDIPIAIG---GSRER----RGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDS-V--HCHG--------------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGK-F-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLL--IA--RQG----VKLKFDDFQQTTQEHVWPR--LNKADLIATARKTWDERR----G--GR----GVRLVGLHVTLLDP----------------
3 PsiBlast_PDB 67.7840% -18 - C1 - - 4Q43 DPO4_ECOLI A:[2-342] -------------------------------------------------------------------SRKIIHVDMDCFFAAVEMRDNPALRDIPIAIG---GSRER----RGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDS-V--HCHG--------------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGK-F-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLL--IA--RQG----VKLKFDDFQQTTQEHVWPR--LNKADLIATARKTWDERR----G--GR----GVRLVGLHVTLLDP----------------
4 PsiBlast_PDB 67.6140% -17 - C1 - - 5C5J ? F:[2-342] -------------------------------------------------------------------SRKIIHVDMDCFFAAVEMRDNPALRDIPIAIG---GSRER----RGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDS-V--HCHG--------------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGK-F-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLL--IA--RQG----VKLKFDDFQQTTQEHVWPR--LNKADLIATARKTWDERR----G--GR----GVRLVGLHVTLLDP----------------
2 PsiBlast_PDB 67.5340% -17 - C1 - - 4IR9 DPO4_ECOLI F:[2-342] -------------------------------------------------------------------SRKIIHVDMDCFFAAVEMRDNPALRDIPIAIG---GSRER----RGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDS-V--HCHG--------------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGK-F-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLL--IA--RQG----VKLKFDDFQQTTQEHVWPR--LNKADLIATARKTWDERR----G--GR----GVRLVGLHVTLLDP----------------
24 PsiBlast_CBE 67.0240% -20 - C1 - - 4IR1 DPO4_ECOLI A:[2-342] -------------------------------------------------------------------SRKIIHVDMDCFFAAVEMRDNPALRDIPIAIG---GSRER----RGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDS-V--HCHG--------------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGK-F-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLL--IA--RQG----VKLKFDDFQQTTQEHVWPR--LNKADLIATARKTWDERR----G--GR----GVRLVGLHVTLLDP----------------
27 PsiBlast_CBE 66.3041% 16 - C1 - - 4IRK DPO4_ECOLI A:[2-342] -------------------------------------------------------------------SRKIIHVDMDCFFAAVEMRDNPALRDIPIAI-------GGSRERRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDS-V--HCHG--------------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQACDLVMLLKRFGK-F-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLL--IA--RQG----VKLKFDDFQQTTQEHVWPR--LNKADLIATARKTWDERR----G--GR----GVRLVGLHVTLLDP----------------
23 PsiBlast_CBE 66.2540% -18 - C1 - - 4IR9 DPO4_ECOLI A:[2-342] -------------------------------------------------------------------SRKIIHVDMDCFFAAVEMRDNPALRDIPIAIG---GSRER----RGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDS-V--HCHG--------------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGK-F-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLL--IA--RQG----VKLKFDDFQQTTQEHVWPR--LNKADLIATARKTWDERR----G--GR----GVRLVGLHVTLLDP----------------
8 PsiBlast_PDB 65.9841% 9 - C1 - - 4Q44 DPO4_ECOLI A:[2-342] -------------------------------------------------------------------SRKIIHVDMDCFFAAVEMRDNPALRDIPIAI-------GGSRERRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDS-V--HCHG--------------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQACDLVMLLKRFGK-F-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLL--IA--RQG----VKLKFDDFQQTTQEHVWPR--LNKADLIATARKTWDERR----G--GR----GVRLVGLHVTLLDP----------------
28 PsiBlast_CBE 65.4341% 17 - C1 - - 4IRD DPO4_ECOLI A:[2-342] -------------------------------------------------------------------SRKIIHVDMDCFFAAVEMRDNPALRDIPIAI-------GGSRERRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDS-V--HCHG--------------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQACDLVMLLKRFGK-F-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLL--IA--RQG----VKLKFDDFQQTTQEHVWPR--LNKADLIATARKTWDERR----G--GR----GVRLVGLHVTLLDP----------------
5 PsiBlast_PDB 64.8941% 18 - C1 - - 4IRC DPO4_ECOLI F:[2-342] -------------------------------------------------------------------SRKIIHVDMDCFFAAVEMRDNPALRDIPIAI-------GGSRERRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDS-V--HCHG--------------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQACDLVMLLKRFGK-F-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLL--IA--RQG----VKLKFDDFQQTTQEHVWPR--LNKADLIATARKTWDERR----G--GR----GVRLVGLHVTLLDP----------------
26 PsiBlast_CBE 64.6441% 14 - C1 - - 4Q44 DPO4_ECOLI F:[2-342] -------------------------------------------------------------------SRKIIHVDMDCFFAAVEMRDNPALRDIPIAI-------GGSRERRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDS-V--HCHG--------------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQACDLVMLLKRFGK-F-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLL--IA--RQG----VKLKFDDFQQTTQEHVWPR--LNKADLIATARKTWDERR----G--GR----GVRLVGLHVTLLDP----------------
9 PsiBlast_PDB 64.2641% 16 - C1 - - 4Q45 DPO4_ECOLI F:[2-342] -------------------------------------------------------------------SRKIIHVDMDCFFAAVEMRDNPALRDIPIAI-------GGSRERRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDS-V--HCHG--------------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQACDLVMLLKRFGK-F-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLL--IA--RQG----VKLKFDDFQQTTQEHVWPR--LNKADLIATARKTWDERR----G--GR----GVRLVGLHVTLLDP----------------
6 PsiBlast_PDB 64.1641% 16 - C1 - - 4IRD DPO4_ECOLI F:[2-342] -------------------------------------------------------------------SRKIIHVDMDCFFAAVEMRDNPALRDIPIAI-------GGSRERRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDS-V--HCHG--------------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQACDLVMLLKRFGK-F-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLL--IA--RQG----VKLKFDDFQQTTQEHVWPR--LNKADLIATARKTWDERR----G--GR----GVRLVGLHVTLLDP----------------
25 PsiBlast_CBE 63.9741% 14 - C1 - - 4Q45 DPO4_ECOLI A:[2-342] -------------------------------------------------------------------SRKIIHVDMDCFFAAVEMRDNPALRDIPIAI-------GGSRERRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDS-V--HCHG--------------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQACDLVMLLKRFGK-F-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLL--IA--RQG----VKLKFDDFQQTTQEHVWPR--LNKADLIATARKTWDERR----G--GR----GVRLVGLHVTLLDP----------------