@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : I3U217: (2017-12-21 )
MTTQELDELAHSEAGAFITKSCTINERKGNPEPRYFDVPLGSINSMGLPNLGFSYYLEYALAYEKVQENQNQPLFFSIAGMSVQENLEMLEKIEKSGFNGITELNLSCPNVPGKPQLAYDFEATYETLKEVFSIFSKPLGIKLPPYFDFAHFDQMADILNQFPLTYVNAINSVGNGLYIDTEQEAVVIKPKEGFGGIGGEYIKPTALANVRAFYTRLKPEIQIIGTGGIRTGQDAFEHLLCGASMLQIGTELHKEGPEIFSRIIKELTQIMSEKGYTSIDEFKGKLRTIS

Atome Classification :

(108 SA) -----------------------.........10...-.....20.....-...30........40.........50........60........70.-.......80........90..----...--..---.-100.........110.......120.......130.....----..140.......150.......-160..-..-....170.......180.......190-...---.....200.......210.......220.......230.......240.......250.......260.......270.......280.......290
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) -----------------------MTTQELDELAHSEA-GAFITKSCTINE-RKGNPEPRYFDVPL-GSINSMGLPNLGFSYYLEYALAYEKVQENQNQ-PLFFSIAGMSVQENLEMLEKI----EKS--GF---N-G--ITELNLSCPNVPGKPQLAYDFEATYETLKEVFSIFSK----PLGIKLPPYFDFAHFDQMADIL-NQ-FP-LT-YVNAINSVGNGLYIDTEQEAVVIKP-K-EGF---GGIGGEYIKPTALANVRAFYTRLKPEIQIIGTGGIRTGQDAFEHLLCGASMLQIGTELHKEGPEIFSRIIKELTQIMSEKGYTSIDEFKGKLRTIS
25 PsiBlast_CBE 96.4274% -90 - C2 - - 1DOR PYRDA_LACLM B:[24-311] -----------------------MTIEDLEELKASQA-GAYITKSSTLEK-REGNPLPRYVDLEL-GSINSMGLPNLGFDYYLDYVLKNQK-ENAQEG-PIFFSIAGMSAAENIAMLKKI----QES--DF---S-G--ITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTK----PLGVKLPPYFDLVHFDIMAEIL-NQ-FP-LT-YVNSVNSIGNGLFIDPEAESVVIKP-K-DGF---GGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL-
21 PsiBlast_CBE 96.3574% -92 - C2 - - 2DOR PYRDA_LACLM B:[24-311] -----------------------MTIEDLEELKASQA-GAYITKSSTLEK-REGNPLPRYVDLEL-GSINSMGLPNLGFDYYLDYVLKNQK-ENAQEG-PIFFSIAGMSAAENIAMLKKI----QES--DF---S-G--ITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTK----PLGVKLPPYFDLVHFDIMAEIL-NQ-FP-LT-YVNSVNSIGNGLFIDPEAESVVIKP-K-DGF---GGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL-
23 PsiBlast_CBE 96.1174% -92 - C2 - - 2BSL PYRDA_LACLM B:[24-311] -----------------------MTIEDLEELKASQA-GAYITKSSTLEK-REGNPLPRYVDLEL-GSINSMGLPNLGFDYYLDYVLKNQK-ENAQEG-PIFFSIAGMSAAENIAMLKKI----QES--DF---S-G--ITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTK----PLGVKLPPYFDLVHFDIMAEIL-NQ-FP-LT-YVNSVNSIGNGLFIDPEAESVVIKP-K-DGF---GGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL-
2 PsiBlast_PDB 96.0874% -92 - C2 - - 2DOR PYRDA_LACLM A:[24-311] -----------------------MTIEDLEELKASQA-GAYITKSSTLEK-REGNPLPRYVDLEL-GSINSMGLPNLGFDYYLDYVLKNQK-ENAQEG-PIFFSIAGMSAAENIAMLKKI----QES--DF---S-G--ITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTK----PLGVKLPPYFDLVHFDIMAEIL-NQ-FP-LT-YVNSVNSIGNGLFIDPEAESVVIKP-K-DGF---GGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL-
1 PsiBlast_PDB 95.9774% -91 - C2 - - 1DOR PYRDA_LACLM A:[24-311] -----------------------MTIEDLEELKASQA-GAYITKSSTLEK-REGNPLPRYVDLEL-GSINSMGLPNLGFDYYLDYVLKNQK-ENAQEG-PIFFSIAGMSAAENIAMLKKI----QES--DF---S-G--ITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTK----PLGVKLPPYFDLVHFDIMAEIL-NQ-FP-LT-YVNSVNSIGNGLFIDPEAESVVIKP-K-DGF---GGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL-
22 PsiBlast_CBE 95.6774% -94 - C2 - - 2BX7 PYRDA_LACLM B:[24-311] -----------------------MTIEDLEELKASQA-GAYITKSSTLEK-REGNPLPRYVDLEL-GSINSMGLPNLGFDYYLDYVLKNQK-ENAQEG-PIFFSIAGMSAAENIAMLKKI----QES--DF---S-G--ITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTK----PLGVKLPPYFDLVHFDIMAEIL-NQ-FP-LT-YVNSVNSIGNGLFIDPEAESVVIKP-K-DGF---GGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL-
24 PsiBlast_CBE 95.4974% -90 - C2 - - 1JUE PYRDA_LACLM B:[24-311] -----------------------MTIEDLEELKASQA-GAYITKSSTLEK-REGNPLPRYVDLEL-GSINSMGLPNLGFDYYLDYVLKNQK-ENAQEG-PIFFSIAGMSAAENIAMLKKI----QES--DF---S-G--ITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTK----PLGVKLPPYFDLVHFDIMAEIL-NQ-FP-LT-YVNSVNSIGNGLFIDPEAESVVIKP-K-DGF---GGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL-
8 PsiBlast_PDB 95.3273% -93 - C2 - - 1OVD PYRDA_LACLM A:[24-311] -----------------------MTIEDLEELKASQA-GAYITKSSTLEK-REGNPLPRYVDLEL-GSINSMGLPNLGFDYYLDYVLKNQK-ENAQEG-PIFFSIAGMSAAENIAMLKKI----QES--DF---S-G--ITELNLSCPNVPGEPQLAYDFEATEKLLKEVFTFFTK----PLGVKLPPYFDLVHFDIMAEIL-NQ-FP-LT-YVNSVNSIGNGLFIDPEAESVVIKP-K-DGF---GGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL-
3 PsiBlast_PDB 95.2674% -90 - C2 - - 1JUE PYRDA_LACLM A:[24-311] -----------------------MTIEDLEELKASQA-GAYITKSSTLEK-REGNPLPRYVDLEL-GSINSMGLPNLGFDYYLDYVLKNQK-ENAQEG-PIFFSIAGMSAAENIAMLKKI----QES--DF---S-G--ITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTK----PLGVKLPPYFDLVHFDIMAEIL-NQ-FP-LT-YVNSVNSIGNGLFIDPEAESVVIKP-K-DGF---GGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL-
5 PsiBlast_PDB 95.1074% -91 - C2 - - 2BX7 PYRDA_LACLM A:[24-311] -----------------------MTIEDLEELKASQA-GAYITKSSTLEK-REGNPLPRYVDLEL-GSINSMGLPNLGFDYYLDYVLKNQK-ENAQEG-PIFFSIAGMSAAENIAMLKKI----QES--DF---S-G--ITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTK----PLGVKLPPYFDLVHFDIMAEIL-NQ-FP-LT-YVNSVNSIGNGLFIDPEAESVVIKP-K-DGF---GGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL-
10 PsiBlast_PDB 95.0373% -91 - C2 - - 1JRC PYRDA_LACLM A:[24-311] -----------------------MTIEDLEELKASQA-GAYITKSSTLEK-REGNPLPRYVDLEL-GSIASMGLPNLGFDYYLDYVLKNQK-ENAQEG-PIFFSIAGMSAAENIAMLKKI----QES--DF---S-G--ITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTK----PLGVKLPPYFDLVHFDIMAEIL-NQ-FP-LT-YVNSVNSIGNGLFIDPEAESVVIKP-K-DGF---GGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL-
31 PsiBlast_CBE 94.9873% -93 - C2 - - 1JQX PYRDA_LACLM B:[24-311] -----------------------MTIEDLEELKASQA-GAYITKSSTLEK-REGNPLPAYVDLEL-GSINSMGLPNLGFDYYLDYVLKNQK-ENAQEG-PIFFSIAGMSAAENIAMLKKI----QES--DF---S-G--ITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTK----PLGVKLPPYFDLVHFDIMAEIL-NQ-FP-LT-YVNSVNSIGNGLFIDPEAESVVIKP-K-DGF---GGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL-
26 PsiBlast_CBE 94.9773% -93 - C2 - - 1OVD PYRDA_LACLM B:[24-311] -----------------------MTIEDLEELKASQA-GAYITKSSTLEK-REGNPLPRYVDLEL-GSINSMGLPNLGFDYYLDYVLKNQK-ENAQEG-PIFFSIAGMSAAENIAMLKKI----QES--DF---S-G--ITELNLSCPNVPGEPQLAYDFEATEKLLKEVFTFFTK----PLGVKLPPYFDLVHFDIMAEIL-NQ-FP-LT-YVNSVNSIGNGLFIDPEAESVVIKP-K-DGF---GGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL-
4 PsiBlast_PDB 94.9374% -89 - C2 - - 2BSL PYRDA_LACLM A:[24-311] -----------------------MTIEDLEELKASQA-GAYITKSSTLEK-REGNPLPRYVDLEL-GSINSMGLPNLGFDYYLDYVLKNQK-ENAQEG-PIFFSIAGMSAAENIAMLKKI----QES--DF---S-G--ITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTK----PLGVKLPPYFDLVHFDIMAEIL-NQ-FP-LT-YVNSVNSIGNGLFIDPEAESVVIKP-K-DGF---GGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL-
29 PsiBlast_CBE 94.9073% -92 - C2 - - 1JRB PYRDA_LACLM B:[24-311] -----------------------MTIEDLEELKASQA-GAYITKSSTLEK-REGNPLARYVDLEL-GSINSMGLPNLGFDYYLDYVLKNQK-ENAQEG-PIFFSIAGMSAAENIAMLKKI----QES--DF---S-G--ITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTK----PLGVKLPPYFDLVHFDIMAEIL-NQ-FP-LT-YVNSVNSIGNGLFIDPEAESVVIKP-K-DGF---GGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL-
27 PsiBlast_CBE 94.8973% -92 - C2 - - 1JUB PYRDA_LACLM B:[24-311] -----------------------MTIEDLEELKASQA-GAYITKSSTLEK-REGNPLPRYVDLEL-GSINSMGLPNLGFDYYLDYVLKNQK-ENAQEG-PIFFSIAGMSAAENIAMLKKI----QES--DF---S-G--ITELNLSCPNVPGEPQLAYDFEATEKLLKEVFTFFTK----PLGVKLPPYFDLVHFDIMAEIL-NQ-FP-LT-YVNSVNSIGNGLFIDPEAESVVIKP-K-DGF---GGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL-
7 PsiBlast_PDB 94.7673% -93 - C2 - - 1JUB PYRDA_LACLM A:[24-311] -----------------------MTIEDLEELKASQA-GAYITKSSTLEK-REGNPLPRYVDLEL-GSINSMGLPNLGFDYYLDYVLKNQK-ENAQEG-PIFFSIAGMSAAENIAMLKKI----QES--DF---S-G--ITELNLSCPNVPGEPQLAYDFEATEKLLKEVFTFFTK----PLGVKLPPYFDLVHFDIMAEIL-NQ-FP-LT-YVNSVNSIGNGLFIDPEAESVVIKP-K-DGF---GGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL-
11 PsiBlast_PDB 94.6573% -92 - C2 - - 1JQX PYRDA_LACLM A:[24-311] -----------------------MTIEDLEELKASQA-GAYITKSSTLEK-REGNPLPAYVDLEL-GSINSMGLPNLGFDYYLDYVLKNQK-ENAQEG-PIFFSIAGMSAAENIAMLKKI----QES--DF---S-G--ITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTK----PLGVKLPPYFDLVHFDIMAEIL-NQ-FP-LT-YVNSVNSIGNGLFIDPEAESVVIKP-K-DGF---GGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL-
30 PsiBlast_CBE 94.5873% -90 - C2 - - 1JRC PYRDA_LACLM B:[24-311] -----------------------MTIEDLEELKASQA-GAYITKSSTLEK-REGNPLPRYVDLEL-GSIASMGLPNLGFDYYLDYVLKNQK-ENAQEG-PIFFSIAGMSAAENIAMLKKI----QES--DF---S-G--ITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTK----PLGVKLPPYFDLVHFDIMAEIL-NQ-FP-LT-YVNSVNSIGNGLFIDPEAESVVIKP-K-DGF---GGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL-
28 PsiBlast_CBE 94.5873% -94 - C2 - - 1JQV PYRDA_LACLM B:[24-311] -----------------------MTIEDLEELKASQA-GAYITKSSTLEK-REGNPLPRYVDLEL-GSINSMGLPNLGFDYYLDYVLKNQK-ENAQEG-PIFFSIAGMSAAENIAMLKKI----QES--DF---S-G--ITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTK----PLGVKLPPYFDLVHFDIMAEIL-NQ-FP-LT-YVNSVNSIGNGLFIDPEAESVVIKP-E-DGF---GGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL-
6 PsiBlast_PDB 94.5273% -94 - C2 - - 1JQV PYRDA_LACLM A:[24-311] -----------------------MTIEDLEELKASQA-GAYITKSSTLEK-REGNPLPRYVDLEL-GSINSMGLPNLGFDYYLDYVLKNQK-ENAQEG-PIFFSIAGMSAAENIAMLKKI----QES--DF---S-G--ITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTK----PLGVKLPPYFDLVHFDIMAEIL-NQ-FP-LT-YVNSVNSIGNGLFIDPEAESVVIKP-E-DGF---GGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL-
9 PsiBlast_PDB 94.2873% -91 - C2 - - 1JRB PYRDA_LACLM A:[24-311] -----------------------MTIEDLEELKASQA-GAYITKSSTLEK-REGNPLARYVDLEL-GSINSMGLPNLGFDYYLDYVLKNQK-ENAQEG-PIFFSIAGMSAAENIAMLKKI----QES--DF---S-G--ITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTK----PLGVKLPPYFDLVHFDIMAEIL-NQ-FP-LT-YVNSVNSIGNGLFIDPEAESVVIKP-K-DGF---GGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL-
78 PsiBlast_CBE 81.4354% -34 - C2 - - 3W7H PYRD_TRYCC A:[26-312] ------------------------TEEDLRCMTASSS-GALVSKSCTSAP-RDGNPEPRYMAFPL-GSINSMGLPNLGFDFYLKYA---SDLHDYSKK-PLFLSISGLSVEENVAMVRRLAPVAQEK--GV--------LLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGL----PFGVKMPPYFDIAHFDTAAAVL-NE-FP-LVKFVTCVNSVGNGLVIDAESESVVIKP-K-QGF---GGLGGKYILPTALANVNAFYRRC-PDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTI-
42 PsiBlast_CBE 81.3154% -33 - C2 - - 3W87 PYRD_TRYCC B:[27-313] ------------------------TEEDLRCMTASSS-GALVSKSCTSAP-RDGNPEPRYMAFPL-GSINSMGLPNLGFDFYLKYA---SDLHDYSKK-PLFLSISGLSVEENVAMVRRLAPVAQEK--GV--------LLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGL----PFGVKMPPYFDIAHFDTAAAVL-NE-FP-LVKFVTCVNSVGNGLVIDAESESVVIKP-K-QGF---GGLGGKYILPTALANVNAFYRRC-PDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTI-