@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Q3XX07: (2018-01-01 )
MRKPIIAGNWKMNKTASEAKEFAEAVKNKIPSNDKVDSVIGSPALFLQELMTSAEGTELKISAQNCYWENSGAFTGETSPAALADLGVHYVIIGHSERREYFHETDEDINKKAKAIFANGMTPILCCGESLETYEAGKTAEWIEGQITAGLADLSAEQVSNMVIAYEPIWAIGTGKSADAQIADEICGVVRQTVEKLYGKEVSEAVRIQYGGSVKPENIAEYMAKENVDGALVGGASLQADSFLSLLDAVK

Atome Classification :

(85 SA) -.........10........20......-.-.30.--.--......40......---..50..--.-.---...--.60.--.......70........80........90........100.......110.......120.......130.....-..140.......150.......--160.......170.......180....-...190......--.200.......210.......220.......230.......240.......250
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) -MRKPIIAGNWKMNKTASEAKEFAEAVK-N-KIPS--N--DKVDSVIGSPALFL---QELMTS--A-E---GTE--LKIS--AQNCYWENSGAFTGETSPAALADLGVHYVIIGHSERREYFHETDEDINKKAKAIFANGMTPILCCGESLETYEAG-KTAEWIEGQITAGLADLSAEQV--SNMVIAYEPIWAIGTGKSADAQIADEI-CGVVRQTVEKLY--GKEVSEAVRIQYGGSVKPENIAEYMAKENVDGALVGGASLQADSFLSLLDAVK
1 PsiBlast_PDB 94.0867%-104 - C6 - - 5IBX - TPIS_STRP2 A:[6-254] --RKPFIAGNWKMNKNPEEAKAFVEAVA-S-KLPS--S--DLVEAGIAAPALDL---TTVLAV--A-K---GSN--LKVA--AQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFANGMLPIICCGESLETYEAG-KAAEFVGAQVSAALAGLTAEQV--AASVIAYEPIWAIGTGKSASQDDAQKM-CKVVRDVVAADF--GQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLEAESFLALLDFV-
139 HHSearch 90.9067% -94 - C6 - - 5IBX - TPIS_STRP2 H:[5-255] -SRKPFIAGNWKMNKNPEEAKAFVEAVA-S-KLPS--S--DLVEAGIAAPALDL---TTVLAV--A-K---GSN--LKVA--AQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFANGMLPIICCGESLETYEAG-KAAEFVGAQVSAALAGLTAEQV--AASVIAYEPIWAIGTGKSASQDDAQKM-CKVVRDVVAADF--GQEVADKVRVQYGGSVKPENVASYMA-PDVDGALVGGASLEAESFLALLDFVK
9 PsiBlast_PDB 90.2556% -96 - C6 - - 1BTM TPIS_GEOSE A:[1-248] --RKPIIAGNWKMHKTLAEAVQFVEDVK-G-HVPP--A--DEVISVVCAPFLFL---DRLVQA--A-D---GTD--LKIG--AQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLIPIICCGESLEEREAG-QTNAVVASQVEKALAGLTPEQV--KQAVIAYEPIWAIGTGKSSTPEDANSV-CGHIRSVVSRLF--GPEAAEAIRIQYGGSVKPDNIRDFLAQQQIDGPLVGGASLEPASFLQLVEA--
8 PsiBlast_PDB 90.1657% -99 - C6 - - 2BTM TPIS_GEOSE A:[1-248] --RKPIIAGNWKMNGTLAEAVQFVEDVK-G-HVPP--A--DEVISVVCAPFLFL---DRLVQA--A-D---GTD--LKIG--AQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLIPIICCGESLEEREAG-QTNAVVASQVEKALAGLTPEQV--KQAVIAYEPIWAIGTGKSSTPEDANSV-CGHIRSVVSRLF--GPEAAEAIRIQYGGSVKPDNIRDFLAQQQIDGALVGGASLEPASFLQLVEA--
143 HHSearch 90.0453%-107 - C6 - - 4Y8F - TPIS_CLOPE A:[4-250] -MRTPIIAGNWKMHYTIDEAVKLVEELK-P-LV-K--D--AKCEVVVCPTFVCL---DAVKKA--V-E---GTN--IKVG--AQNMHFEEKGAFTGEIAPRMLEAMNIDYVIIGHSERREYFNETDETCNKKVKAAFAHNLTPILCCGETLEQRENG-TTNDVIKAQITADLEGLTKEQA--EKVVIAYEPIWAIGTGKTATSDQANET-IAAIRAMVAEMF--GQEVADKVRIQYGGSVKPNTIAEQMAKSDIDGALVGGASLVAADFAQIVN---
156 HHSearch 90.0357% -97 - C6 - - 2BTM TPIS_GEOSE A:[1-250] --RKPIIAGNWKMNGTLAEAVQFVEDVK-G-HVPP--A--DEVISVVCAPFLFL---DRLVQA--A-D---GTD--LKIG--AQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLIPIICCGESLEEREAG-QTNAVVASQVEKALAGLTPEQV--KQAVIAYEPIWAIGTGKSSTPEDANSV-CGHIRSVVSRLF--GPEAAEAIRIQYGGSVKPDNIRDFLAQQQIDGALVGGASLEPASFLQLVEAGR
30 PsiBlast_CBE 90.0157% -96 - C6 - - 2BTM TPIS_GEOSE B:[1-248] --RKPIIAGNWKMNGTLAEAVQFVEDVK-G-HVPP--A--DEVISVVCAPFLFL---DRLVQA--A-D---GTD--LKIG--AQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLIPIICCGESLEEREAG-QTNAVVASQVEKALAGLTPEQV--KQAVIAYEPIWAIGTGKSSTPEDANSV-CGHIRSVVSRLF--GPEAAEAIRIQYGGSVKPDNIRDFLAQQQIDGALVGGASLEPASFLQLVEA--
10 PsiBlast_PDB 89.9353%-106 - C6 - - 4Y8F - TPIS_CLOPE A:[4-250] -MRTPIIAGNWKMHYTIDEAVKLVEELK---PLVK--D--AKCEVVVCPTFVCL---DAVKKA--V-E---GTN--IKVG--AQNMHFEEKGAFTGEIAPRMLEAMNIDYVIIGHSERREYFNETDETCNKKVKAAFAHNLTPILCCGETLEQRENG-TTNDVIKAQITADLEGLTKEQA--EKVVIAYEPIWAIGTGKTATSDQANET-IAAIRAMVAEMF--GQEVADKVRIQYGGSVKPNTIAEQMAKSDIDGALVGGASLVAADFAQIVN---
31 PsiBlast_CBE 88.7756% -96 - C6 - - 1BTM TPIS_GEOSE B:[1-248] --RKPIIAGNWKMHKTLAEAVQFVEDVK-G-HVPP--A--DEVISVVCAPFLFL---DRLVQA--A-D---GTD--LKIG--AQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLIPIICCGESLEEREAG-QTNAVVASQVEKALAGLTPEQV--KQAVIAYEPIWAIGTGKSSTPEDANSV-CGHIRSVVSRLF--GPEAAEAIRIQYGGSVKPDNIRDFLAQQQIDGPLVGGASLEPASFLQLVEA--
142 HHSearch 88.6246%-116 - C6 - - 1B9B - B:[2-250] -TRKLILAGNWKMHKTISEAKKFVSLLV-N-ELHD--V--KEFEIVVCPPFTAL---SEVGEI--L-S---GRN--IKLG--AQNVFYEDQGAFTGEISPLMLQEIGVEYVIVGHSERRRIFKEDDEFINRKVKAVLEKGMTPILCVGETLEEREKG-LTFCVVEKQVREGFYGLDKEEA--KRVVIAYEPVWAIGTGRVATPQQAQEV-HAFIRKLLSEMY--DEETAGSIRILYGGSIKPDNFLGLIVQKDIDGGLVGGASLKE-SFIELARIM-
11 PsiBlast_PDB 85.9446%-107 - C6 - - 1B9B - PGKT_THEMA A:[3-246] --RKLILAGNWKMHKTISEAKKFVSLLV-N-ELHD--V--KEFEIVVCPPFTAL---SEVGEI--L-S---GRN--IKLG--AQNVFYEDQGAFTGEISPLMLQEIGVEYVIVGHSERRRIFKEDDEFINRKVKAVLEKGMTPILCVGETLEEREKG-LTFCVVEKQVREGFYGLDKEEA--KRVVIAYEPVWAIGTGRVATPQQAQEV-HAFIRKLLSEMY--DEETAGSIRILYGGSIKPDNFLGLIVQKDIDGGLVGGASLK-ESFIEL-----
71 PsiBlast_CBE 83.8143%-105 - C6 - - 2I9E ? C:[3-245] --RKFVVGGNWKMNGDKKQINEIIGFLK-S-G-PL--N--QDTEVVVGVPAIYL----ELVRT--C-V---PAS--IGVA--AQNCYKVPKGAFTGEISPAMIKDVGADWVILGHSERRQIFGESDELIAEKVCHALESGLKVIACIGETLEEREAG-KTEEVVFRQTKAIAAKVN--DW--SNVVIAYEPVWAIGTGKTATPQQAQDV-HKALRQWICENI--DAKVGNSIRIQYGGSVTAANCKELASQPDIDGFLVGGASLKPE-FVDIINA--
72 PsiBlast_CBE 83.7543%-104 - C6 - - 2I9E ? B:[3-245] --RKFVVGGNWKMNGDKKQINEIIGFLK-S-G-PL--N--QDTEVVVGVPAIYL----ELVRT--C-V---PAS--IGVA--AQNCYKVPKGAFTGEISPAMIKDVGADWVILGHSERRQIFGESDELIAEKVCHALESGLKVIACIGETLEEREAG-KTEEVVFRQTKAIAAKVN--DW--SNVVIAYEPVWAIGTGKTATPQQAQDV-HKALRQWICENI--DAKVGNSIRIQYGGSVTAANCKELASQPDIDGFLVGGASLKPE-FVDIINA--
138 HHSearch 83.6643%-101 - C6 - - 4Y96 - ? B:[6-254] -TRKKFVAGNWKMNTTLAEAKALGAAVA-K-GV-T--D--DRVTVAVFPPYPWL---TAVGEV--L-K---GSP--VALG--AQDVSSEKKGAFTGEVSPAMLLETGCKYALIGHSERRHIIGESETFINHKVHTALEEGLSVVLCMGETLAERERG-LQERVFQRQVYAACAGLTDEQF--GRIVIAYEPVWAIGTGKVATPEQAQEA-HAFVRSKLRLLY--GDKIADSTPIVYGGSVTPDNTVGLMSQPDVDGALVGGASLKADSFLAIVKAA-
73 PsiBlast_CBE 83.5843%-104 - C6 - - 2I9E ? A:[3-245] --RKFVVGGNWKMNGDKKQINEIIGFLK-S-G-PL--N--QDTEVVVGVPAIYL----ELVRT--C-V---PAS--IGVA--AQNCYKVPKGAFTGEISPAMIKDVGADWVILGHSERRQIFGESDELIAEKVCHALESGLKVIACIGETLEEREAG-KTEEVVFRQTKAIAAKVN--DW--SNVVIAYEPVWAIGTGKTATPQQAQDV-HKALRQWICENI--DAKVGNSIRIQYGGSVTAANCKELASQPDIDGFLVGGASLKPE-FVDIINA--
16 PsiBlast_PDB 83.5343%-106 - C6 - - 4Y96 - ? A:[7-253] --RKKFVAGNWKMNTTLAEAKALGAAVA-K-GV-T--D--DRVTVAVFPPYPWL---TAVGEV--L-K---GSP--VALG--AQDVSSEKKGAFTGEVSPAMLLETGCKYALIGHSERRHIIGESETFINHKVHTALEEGLSVVLCMGETLAERERG-LQERVFQRQVYAACAGLTDEQF--GRIVIAYEPVWAIGTGKVATPEQAQEA-HAFVRSKLRLLY--GDKIADSTPIVYGGSVTPDNTVGLMSQPDVDGALVGGASLKADSFLAIVKA--
85 PsiBlast_CBE 83.4039%-108 - C6 - - 2Y63 TPIS_LEIME A:[6-251] ---QPIAAANWKCNGTTASIEKLVQVFN-E-HTIS--H--D-VQCVVAPTFVHI---PLVQAK--L-R---NPK--YVIS--AQNAI-AKSGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVAQKVSEACKQGFMVIACIGETLQQREAN-QTAKVVLSQTSAIAAKLTKDAW--NQVVLAYEPVWAIGTGKVATPEQAQEV-HLLLRKWVSENI--GTDVAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKPE-FRDIIDATR
90 PsiBlast_CBE 83.3239%-107 - C6 - - 1N55 TPIS_LEIME A:[6-251] ---QPIAAANWKCNGTTASIEKLVQVFN-E-HTIS--H--D-VQCVVAPTFVHI---PLVQAK--L-R---NPK--YVIS--AQNAI-AKSGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVAQKVSEACKQGFMVIACIGETLQQREAN-QTAKVVLSQTSAIAAKLTKDAW--NQVVLAYEPVWAIGTGKVATPEQAQEV-HLLLRKWVSENI--GTDVAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKPE-FRDIIDATR
87 PsiBlast_CBE 83.2939%-105 - C6 - - 2Y61 TPIS_LEIME A:[6-251] ---QPIAAANWKCNGTTASIEKLVQVFN-E-HTIS--H--D-VQCVVAPTFVHI---PLVQAK--L-R---NPK--YVIS--AQNAI-AKSGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVAQKVSEACKQGFMVIACIGETLQQREAN-QTAKVVLSQTSAIAAKLTKDAW--NQVVLAYEPVWAIGTGKVATPEQAQEV-HLLLRKWVSENI--GTDVAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKPE-FRDIIDATR
70 PsiBlast_CBE 83.2543%-103 - C6 - - 2I9E ? D:[3-245] --RKFVVGGNWKMNGDKKQINEIIGFLK-S-G-PL--N--QDTEVVVGVPAIYL----ELVRT--C-V---PAS--IGVA--AQNCYKVPKGAFTGEISPAMIKDVGADWVILGHSERRQIFGESDELIAEKVCHALESGLKVIACIGETLEEREAG-KTEEVVFRQTKAIAAKVN--DW--SNVVIAYEPVWAIGTGKTATPQQAQDV-HKALRQWICENI--DAKVGNSIRIQYGGSVTAANCKELASQPDIDGFLVGGASLKPE-FVDIINA--
86 PsiBlast_CBE 83.1039%-106 - C6 - - 2Y62 TPIS_LEIME A:[6-251] ---QPIAAANWKCNGTTASIEKLVQVFN-E-HTIS--H--D-VQCVVAPTFVHI---PLVQAK--L-R---NPK--YVIS--AQNAI-AKSGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVAQKVSEACKQGFMVIACIGETLQQREAN-QTAKVVLSQTSAIAAKLTKDAW--NQVVLAYEPVWAIGTGKVATPEQAQEV-HLLLRKWVSENI--GTDVAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKPE-FRDIIDATR
91 PsiBlast_CBE 82.9339%-103 - C6 - - 1IF2 TPIS_LEIME A:[6-251] ---QPIAAANWKCNGTTASIEKLVQVFN-E-HTIS--H--D-VQCVVAPTFVHI---PLVQAK--L-R---NPK--YVIS--AQNAI-AKSGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVAQKVSEACKQGFMVIACIGETLQQREAN-QTAKVVLSQTSAIAAKLTKDAW--NQVVLAYEPVWAIGTGKVATPEQAQEV-HLLLRKWVSENI--GTDVAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKPE-FRDIIDATR
4 PsiBlast_PDB 82.8760% -14 - C6 - - 3UWV TPIS_STAAR A:[9-261] -MRTPIIAGNWKMNKTVQEAKDFVNALP-T--LPD--S--KEVESVICAPAIQL---DALTTA--VKE---GKAQGLEIG--AQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESG-KANDVVGEQVKKAVAGLSEDQL--KSVVIAYEPIWAIGTGKSSTSEDANEM-CAFVRQTIADLS--SKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGAK
88 PsiBlast_CBE 82.7839%-107 - C6 - - 2VXN TPIS_LEIME A:[6-251] ---QPIAAANWKCNGTTASIEKLVQVFN-E-HTIS--H--D-VQCVVAPTFVHI---PLVQAK--L-R---NPK--YVIS--AQNAI-AKSGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVAQKVSEACKQGFMVIACIGETLQQREAN-QTAKVVLSQTSAIAAKLTKDAW--NQVVLAYEPVWAIGTGKVATPEQAQEV-HLLLRKWVSENI--GTDVAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKPE-FRDIIDATR
41 PsiBlast_CBE 82.7643%-102 - C6 - - 4MVA ? A:[25-272] -MRHPLVMGNWKLNGSRHMVHELVSNLR-K-ELAG--V--AGCAVAIAPPEMYI---DMAKRE--A-E---GSH--IMLG--AQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLCIGETEAENEAG-KTEEVCARQIDAVLKTQGAAAF--EGAVIAYEPVWAIGTGKSATPAQAQAV-HKFIRDHIAKV---DANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKA--
5 PsiBlast_PDB 82.6960% -15 - C6 - - 3UWW TPIS_STAAR A:[9-261] -MRTPIIAGNWKMNKTVQEAKDFVNALP-T--LPD--S--KEVESVICAPAIQL---DALTTA--VKE---GKAQGLEIG--AQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESG-KANDVVGEQVKKAVAGLSEDQL--KSVVIAYEPIWAIGTGKSSTSEDANEM-CAFVRQTIADLS--SKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGAK
89 PsiBlast_CBE 82.5939%-105 - C6 - - 1QDS TPIS_LEIME A:[6-251] ---QPIAAANWKCNGTTASIEKLVQVFN-E-HTIS--H--D-VQCVVAPTFVHI---PLVQAK--L-R---NPK--YVIS--AQNAI-AKSGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVAQKVSEACKQGFMVIACIGETLQQREAN-QTAKVVLSQTSAIAAKLTKDAW--NQVVLAYEPVWAIGTGKVATPEQAQEV-HLLLRKWVSENI--GTDVAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKPE-FRDIIDATR
28 PsiBlast_CBE 82.3560% -15 - C6 - - 3UWV TPIS_STAAR B:[9-261] -MRTPIIAGNWKMNKTVQEAKDFVNALP-T--LPD--S--KEVESVICAPAIQL---DALTTA--VKE---GKAQGLEIG--AQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESG-KANDVVGEQVKKAVAGLSEDQL--KSVVIAYEPIWAIGTGKSSTSEDANEM-CAFVRQTIADLS--SKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGAK
148 HHSearch 82.2239%-103 - C6 - - 2VXN TPIS_LEIME A:[4-250] -KPQPIAAANWKCNGTTASIEKLVQVFN-E-HT-I--S--HDVQCVVAPTFVHI---PLVQAK--L-R---NPK--YVIS--AQNAI-AKSGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVAQKVSEACKQGFMVIACIGETLQQREAN-QTAKVVLSQTSAIAAKLTKDAW--NQVVLAYEPVWAIGTGKVATPEQAQEV-HLLLRKWVSENI--GTDVAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKPE-FRDIIDAT-
25 PsiBlast_CBE 82.1960% -14 - C6 - - 3M9Y TPIS_STAAR B:[2-254] -MRTPIIAGNWKMNKTVQEAKDFVNALP-T--LPD--S--KEVESVICAPAIQL---DALTTA--VKE---GKAQGLEIG--AQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESG-KANDVVGEQVKKAVAGLSEDQL--KSVVIAYEPIWAIGTGKSSTSEDANEM-CAFVRQTIADLS--SKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGAK
40 PsiBlast_CBE 82.1443%-104 - C6 - - 4MVA ? B:[25-272] -MRHPLVMGNWKLNGSRHMVHELVSNLR-K-ELAG--V--AGCAVAIAPPEMYI---DMAKRE--A-E---GSH--IMLG--AQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLCIGETEAENEAG-KTEEVCARQIDAVLKTQGAAAF--EGAVIAYEPVWAIGTGKSATPAQAQAV-HKFIRDHIAKV---DANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKA--
100 PsiBlast_CBE 81.8639%-101 - C6 - - 1AMK TPIS_LEIME A:[6-251] ---QPIAAANWKCNGTTASIEKLVQVFN-E-HTIS--H--D-VQCVVAPTFVHI---PLVQAK--L-R---NPK--YVIS--AENAI-AKSGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVAQKVSEACKQGFMVIACIGETLQQREAN-QTAKVVLSQTSAIAAKLTKDAW--NQVVLAYEPVWAIGTGKVATPEQAQEV-HLLLRKWVSENI--GTDVAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKPE-FRDIIDATR
7 PsiBlast_PDB 81.8360% -14 - C6 - - 3UWZ TPIS_STAAR A:[9-261] -MRTPIIAGNWKMNKTVQEAKDFVNALP-T--LPD--S--KEVESVICAPAIQL---DALTTA--VKE---GKAQGLEIG--AQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESG-KANDVVGEQVKKAVAGLSEDQL--KSVVIAYEPIWAIGTGKSSTSEDANEM-CAFVRQTIADLS--SKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGAK
29 PsiBlast_CBE 81.5060% -10 - C6 - - 3UWU TPIS_STAAR B:[9-260] -MRTPIIAGNWKMNKTVQEAKDFVNALP-T--LPD--S--KEVESVICAPAIQL---DALTTA--VKE---GKAQGLEIG--AQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESG-KANDVVGEQVKKAVAGLSEDQL--KSVVIAYEPIWAIGTGKSSTSEDANEM-CAFVRQTIADLS--SKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGA-
3 PsiBlast_PDB 81.4060% -9 - C6 - - 3UWU TPIS_STAAR A:[9-261] -MRTPIIAGNWKMNKTVQEAKDFVNALP-T--LPD--S--KEVESVICAPAIQL---DALTTA--VKE---GKAQGLEIG--AQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESG-KANDVVGEQVKKAVAGLSEDQL--KSVVIAYEPIWAIGTGKSSTSEDANEM-CAFVRQTIADLS--SKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGAK
154 HHSearch 81.0860% -12 - C6 - - 3M9Y TPIS_STAAR B:[2-254] -MRTPIIAGNWKMNKTVQEAKDFVNALP-T-LP-D--S--KEVESVICAPAIQL---DALTTA--V-KEGKAQG--LEIG--AQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESG-KANDVVGEQVKKAVAGLSEDQL--KSVVIAYEPIWAIGTGKSSTSEDANEM-CAFVRQTIADLS--SKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGAK
26 PsiBlast_CBE 80.8360% -17 - C6 - - 3UWZ TPIS_STAAR B:[9-261] -MRTPIIAGNWKMNKTVQEAKDFVNALP-T--LPD--S--KEVESVICAPAIQL---DALTTA--VKE---GKAQGLEIG--AQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESG-KANDVVGEQVKKAVAGLSEDQL--KSVVIAYEPIWAI---KSSTSEDANEM-CAFVRQTIADLS--SKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGAK
27 PsiBlast_CBE 80.6460% -9 - C6 - - 3UWW TPIS_STAAR B:[10-260] --RTPIIAGNWKMNKTVQEAKDFVNALP-T--LPD--S--KEVESVICAPAIQL---DALTTA--VKE---GKAQGLEIG--AQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESG-KANDVVGEQVKKAVAGLSEDQL--KSVVIAYEPIWAIGTGKSSTSEDANEM-CAFVRQTIADLS--SKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGA-
155 HHSearch 80.3436%-100 - C6 - - 4MKN ? A:[18-264] -SAKFFVGGNWKCNGSVANVAKLVDELN-A-GT-I--P--RGVDVVVAPPFIYI---DYVMQH--L-D---RDK--YQLS--AQNAWIGGNGAFTGEVSAEQLTDFGVPWVILGHSERRSLFGESNEVVAKKTSHALAAGLGVIACIGETLEQRNSG-SVFKVLDAQMDALVDEV--KDW--TKVVLAYEPVWAIGTGVVASPEQAQEV-HAYLRQYCAKKL--GAAVADKLRIIYGGSVSDTNCKDLSKQEDIDGFLVGGASLKGAAFVTICNAA-
141 HHSearch 78.8539% -90 - C6 - - 3YPI TPIS_YEAST B:[1-246] -ARTFFVGGNFKLNGSKQSIKEIVERLN-T-AS-I--P--ENVEVVICPPATYL---DYSVSL--V-K---KPQ--VTVG--AQNAYLKASGAFTGENSVDQIKDVGAKWVILGQSERRSYFHEDDKFIADKTKFALGQGVGVILCIGETLEEKKAG-KTLDVVERQLNAVLEEV--KDW--TNVVVAYEPVWAIGTGLAATPEDAQDI-HASIRKFLASKL--GDKAASELRILYGGSANGSNAVTFKDKADVDGFLVGGASLKPE-FVDIINSR-
159 Fugue 78.5656% -5 - C6 - - 2BTM TPIS_GEOSE A:[1-250] --RKPIIAGNWKMNGTLAEAVQFVEDVK-G-HVPP--A--DEVISVVCAPFLFL---DRLVQAAD------GTD--LKIG--AQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLIPIICCGESLEEREAG-QTNAVVASQVEKALAGLTPEQV--KQAVIAYEPIWAIGTGKSSTPEDANSV-CGHIRSVVSRLF--GPEAAEAIRIQYGGSVKPDNIRDFLAQQQIDGALVGGASLEPASFLQLVEAGR
149 HHSearch 75.9038% -92 - C6 - - 4Z0J TPIS_PLAFA B:[2-247] -ARKYFVAANWKCNGTLESIKSLTNSFN-N-LDFD--P--SKLDVVVFPVSVHY---DHTRKL--L-Q----SK--FSTG--IQNVSKFGNGAYTGEVSAEIAKDLNIEYVIIGHSERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQN-KTIEVITKQVKAFVDLI--DNF--DNVILVYEPLWAIGTGKTATPEQAQLV-HKEIRKIVKDTC--GEKQANQIRILYGGS------SSLIQQEDIDGFLVGNASLKE-SFVDIIKSA-
37 PsiBlast_CBE 72.5843% 13 - C6 - - 4YMZ TPIS_LEPIN B:[3-251] --RKTIIAGNWKMNLSLKEAVFLAHSIR-E-KIPSISK--DKVSMVFPS-TLHL---ENVSKI--L-E---GSS--VIVG--AQNCYHSGLAAFTGETSPDQLKEIGVKVVMVGHSERRQFLGESNFFCNDKIRFLLKNEFTVLYCVGETLSERESG-KTLEVLSSQIREGLKGIDSVFF--SNLILAYEPVWAIGTGKVATPSQAQEV-HSFIRKEISGLFVGASSISESISILYGGSVKPDNIQDLLKEKDIDGGLVGGASQKISSFAGLF----
19 PsiBlast_PDB 72.5743% 12 - C6 - - 4YMZ TPIS_LEPIN A:[3-251] --RKTIIAGNWKMNLSLKEAVFLAHSIR-E-KIPSISK--DKVSMVFPS-TLHL---ENVSKI--L-E---GSS--VIVG--AQNCYHSGLAAFTGETSPDQLKEIGVKVVMVGHSERRQFLGESNFFCNDKIRFLLKNEFTVLYCVGETLSERESG-KTLEVLSSQIREGLKGIDSVFF--SNLILAYEPVWAIGTGKVATPSQAQEV-HSFIRKEISGLFVGASSISESISILYGGSVKPDNIQDLLKEKDIDGGLVGGASQKISSFAGLF----