@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Q3XXS4: (2018-01-05 )
MTKLSEMLQETTQFILDKGVKEIDFGLILGSGLGELADEIEDAVMISYDEIPFFPVSTVVGHAGKLVYGSLAGKKVLAMQGRFHYYEGHSMQTVTYPVRVMAGLGAHSVIVTNACGGVNESFVPGDLMLITDHINFTGENPLIGPNEDAMGPRFPDMSQAYTPDYQATAKAAAEKLGLDLKEGVYMGYSGPTYETPAEIRMSRTIGADAVGMSTVPEVIVAAHSGLKVLGISCITNLAAGMQANLSHEEVVETTQRVKQSFKALVKETLTLL

Atome Classification :

(52 SA) .........10........-20........30........40..-......50........60........70........80........90........100.......110.......120.......130...---..---.---.---140.......150.......160.......-170.....--.--.--180.........190.......200.......210.......220.......230....-----------------...-240-..---...---....250.-.....--.260.......270
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) MTKLSEMLQETTQFILDKG-VKEIDFGLILGSGLGELADEIEDA-VMISYDEIPFFPVSTVVGHAGKLVYGSLAGKKVLAMQGRFHYYEGHSMQTVTYPVRVMAGLGAHSVIVTNACGGVNESFVPGDLMLITDHIN---FT---G---E---NPLIGPNEDAMGPRFPDMSQAYTPDYQATA-KAAAEKLG--L--D--L--KEGVYMGYSGPTYETPAEIRMSRTIGADAVGMSTVPEVIVAAHSGLKVLGISCITN-----------------LAA-G---MQ---ANL---SHEEVVET-TQRVK--QSFKALVKETLTLL
116 HHSearch 96.4664%-126 - C4 - - 3LBA ? A:[36-303] --SLLKKIYETRDFLTAKG-VQKPEFGLILGSGLGELAEEIENA-LVLNYADIPNWGRS------GKLIYGELAGRKVLALQGRFHYYEGNSMELVTFPIRIMKALGCQGLIVTNAAGGIG--FGPGTLMAISDHIN---LT---G---A---NPLMGENLDDFGFRFPDMSNAYTADYREVA-HQVADKIG--I--K--L--DEGVYIGVSGPSYETPAEIRAFKTLGADAVGMSTVPEVIVAVHSGLKVLGISAITN-----------------YAA-G---FQ---SEL---N---VVAV-TQQIK--EDFKGLVKAILVEL
2 PsiBlast_PDB 95.8563%-127 - C4 - - 3LBA ? A:[37-303] ---LLKKIYETRDFLTAKG-VQKPEFGLILGSGLGELAEEIENA-LVLNYADIPNWGRS------GKLIYGELAGRKVLALQGRFHYYEGNSMELVTFPIRIMKALGCQGLIVTNAAGGI--GFGPGTLMAISDHIN---LT---G---A---NPLMGENLDDFGFRFPDMSNAYTADYREVA-HQVADKIG--I--K--L--DEGVYIGVSGPSYETPAEIRAFKTLGADAVGMSTVPEVIVAVHSGLKVLGISAITN-----------------YAA-G---FQ---SEL---N---VVAV-TQQIK--EDFKGLVKAILVEL
111 HHSearch 92.8146%-105 - C4 - - 4M1E ? D:[24-295] -SELKSRIDQATAKISQLW-QGEPAVGMILGTGLGGLAEQIEQD-IAIPYSDIPHFPTSTVKSHAGRLVCGRLRGIPIVAMEGRFHYYEGYSLEQVTFPVRVMKAMGVKTLLVTNAAGGINPQLDLSDVLIIEDHIN---LM---P---E---NPLRGPNDEELGPRFPDMSHPYDCQHMEVA-RQVALELG--I--H--C--PKGVFVAVSGPNLETRAEYRMLKLMGADVVGMSTVPEVLVAVHAGLRVLGFSVVTD-----------------LCL-P---DAL--EPV---ELNKILEV-AARGG--AKLARLIPEILPRI
110 HHSearch 92.4346%-108 - C4 - - 4M1E ? A:[25-295] --ELKSRIDQATAKISQLW-QGEPAVGMILGTGLGGLAEQIEQD-IAIPYSDIPHFPTSTVKSHAGRLVCGRLRGIPIVAMEGRFHYYEGYSLEQVTFPVRVMKAMGVKTLLVTNAAGGINPQLDLSDVLIIEDHIN---LM---P---E---NPLRGPNDEELGPRFPDMSHPYDCQHMEVA-RQVALELG--I--H--C--PKGVFVAVSGPNLETRAEYRMLKLMGADVVGMSTVPEVLVAVHAGLRVLGFSVVTD-----------------LCL-P---DAL--EPV---ELNKILEV-AARGG--AKLARLIPEILPRI
117 HHSearch 91.3064%-137 - C4 - - 3LA8 - ? A:[36-303] --SLLKKIYETRDFLTAKG-VQKPEFGLILGSGLGELAEEIENA-LVLNYADIPNWG---------KLIYGELAGRKVLALQ-RFHYYEG-SMELVTFPIRIMKALGCQGLIVTNAAGGIG--FGPGTLMAISDHIN---LT---G---A---NPLMG-NLDDFGFRFPDMSNAYTADYREVA-HQVADKIG--I--K--L--DEGVYIGVSGPSYETPAEIRAFKTLGADAVGMSTVPEVIVAVHSGLKVLGISAITN-----------------YAA-G---F---------------VAV-TQQIK--EDFKGLVKAILVEL
1 PsiBlast_PDB 90.7863%-139 - C4 - - 3LA8 - ? A:[37-303] ---LLKKIYETRDFLTAKG-VQKPEFGLILGSGLGELAEEIENA-LVLNYADIPNWG---------KLIYGELAGRKVLALQ-RFHYYEG-SMELVTFPIRIMKALGCQGLIVTNAAGGI--GFGPGTLMAISDHIN---LT---G---A---NPLMG-NLDDFGFRFPDMSNAYTADYREVA-HQVADKIG--I--K--L--DEGVYIGVSGPSYETPAEIRAFKTLGADAVGMSTVPEVIVAVHSGLKVLGISAITN-----------------YAA-G---F---------------VAV-TQQIK--EDFKGLVKAILVEL
123 HHSearch 89.9447% -98 * C4 * - 3FUC PNPH_BOVIN A:[5-282] --YTYEDYQDTAKWLLSHT-EQRPQVAVICGSGLGGLVNKLTQA-QTFDYSEIPNFP--------GRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHIN---LP---GFSGE---NPLRGPNEERFGVRFPAMSDAYDRDMRQKA-HSTWKQMG--EQRE--L--QEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITN-----------------KVI-M---DYESQGKA---NHEEVLEA-GKQAA--QKLEQFVSLLMASI
113 HHSearch 89.3148% -85 - C4 - - 4LNA ? A:[22-293] --SMFEQIQETTQFIQSKI-TLRPAIGIILGTGLGALTNELDID-TTIPYETIPHFPLSTV---SGKLLIGTLGGKSVVVMQGRFHYYEGYTMQQVTYPVRVMHALGIQTLLVSNAAGGMNPTFQTSDLMVIDDHIS---LLL--P---Q---NPLICPNPPIFGDRFPDMSEPYRKSLIDLA-FSVAAELD--I--P--L--KRGVYVSVTGPQLETRAEYRMLRQWGADAVGMSTVPEVIVANQLGMDVFGISVITD-----------------LCF-P---DTL--EKA---ELVKILAT-AAQAE--PKLTMLIREMIGRL
12 PsiBlast_PDB 89.0648% -89 - C4 - - 1B8N PNPH_BOVIN A:[8-275] -----EDYQDTAKWLLSHT-EQRPQVAVICGSGLGGLVNKLTQA-QTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS---G---E---NPLRGPNEERFGVRFPAMSDAYDRDMRQKA-HSTWKQMGEQR--E--L--QEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVI--------------MDY-E---SQ---GKA---NHEEVLEA-GKQAA--QKLEQFV-------
118 HHSearch 88.8247% -98 - C4 - - 4NSN ? C:[25-295] --LQEQHYHEAASFLSSRL-PGDAKTAIILGSGLGELAEKIENK-TVIPYNEIPHFAQATAVGHKGNIIGGILGGTPVVAMQGRFHYYEGYSMDQVTFPIRVMKLLGIENLFVSNAAGGINTSFKVGDLMIICDHIN---NL---P-------NPLIGPNMDMFGVRFPDMTRAYDREFIAKA-KGIAQELN--I--P--V--KEGVYVGLTGPSYETPAEYKFWGQVGGDAIGMSTVPEVIVARHTGIRVFGMSVITN-----------------EGY-H---FADD-FVN---DEQDVIRA-ANAAS--EKMGAIFARLIAAV
8 PsiBlast_PDB 88.4548% -86 - C4 - - 1A9S PNPH_BOVIN A:[8-275] -----EDYQDTAKWLLSHT-EQRPQVAVICGSGLGGLVNKLTQA-QTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS---G---E---NPLRGPNEERFGVRFPAMSDAYDRDMRQKA-HSTWKQMGEQR--E--L--QEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVI--------------MDT-E---SQ---GKA---NHEEVLEA-GKQAA--QKLEQFV-------
13 PsiBlast_PDB 88.1848% -88 - C4 - - 1B8O PNPH_BOVIN A:[8-275] -----EDYQDTAKWLLSHT-EQRPQVAVICGSGLGGLVNKLTQA-QTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS---G---E---NPLRGPNEERFGVRFPAMSDAYDRDMRQKA-HSTWKQMGEQR--E--L--QEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVI--------------MDY-E---SQ---GKA---NHEEVLEA-GKQAA--QKLEQFV-------
7 PsiBlast_PDB 88.1848% -87 - C4 - - 1A9P PNPH_BOVIN A:[8-275] -----EDYQDTAKWLLSHT-EQRPQVAVICGSGLGGLVNKLTQA-QTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS---G---E---NPLRGPNEERFGVRFPAMSDAYDRDMRQKA-HSTWKQMGEQR--E--L--QEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVI--------------MDT-E---SQ---GKA---NHEEVLEA-GKQAA--QKLEQFV-------
10 PsiBlast_PDB 88.1448% -88 - C4 - - 4PNP - PNPH_BOVIN A:[8-275] -----EDYQDTAKWLLSHT-EQRPQVAVICGSGLGGLVNKLTQA-QTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS---G---E---NPLRGPNEERFGVRFPAMSDAYDRDMRQKA-HSTWKQMGEQR--E--L--QEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVI--------------MDT-E---SQ---GKA---NHEEVLEA-GKQAA--QKLEQFV-------
59 PsiBlast_CBE 88.1146%-101 - C4 - - 3PHB PNPH_HUMAN S:[43-310] -----EDYKNTAEWLLSHT-KHRPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS---G---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRA-LSTWKQMGEQR--E--L--QEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITN-----------------KVI-M---DY---ESLEKANHEEVLAA-GKQAA--QKLEQFV-------
34 PsiBlast_CBE 88.0746% -97 - C4 - - 3K8O PNPH_HUMAN S:[8-275] -----EDYKNTAEWLLSHT-KHRPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS---G---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRA-LSTWKQMGEQR--E--L--QEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITN-----------------KVI-M---DY---ESLEKANHEEVLAA-GKQAA--QKLEQFV-------
5 PsiBlast_PDB 88.0748% -88 - C4 - - 1A9T PNPH_BOVIN A:[8-275] -----EDYQDTAKWLLSHT-EQRPQVAVICGSGLGGLVNKLTQA-QTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS---G---E---NPLRGPNEERFGVRFPAMSDAYDRDMRQKA-HSTWKQMGEQR--E--L--QEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVI--------------MDT-E---SQ---GKA---NHEEVLEA-GKQAA--QKLEQFV-------
36 PsiBlast_CBE 87.9146% -97 - C4 - - 3K8O PNPH_HUMAN E:[8-275] -----EDYKNTAEWLLSHT-KHRPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS---G---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRA-LSTWKQMGEQR--E--L--QEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITN-----------------KVI-M---DY---ESLEKANHEEVLAA-GKQAA--QKLEQFV-------
15 PsiBlast_PDB 87.9048%-100 - C4 - - 2AI1 PNPH_BOVIN A:[8-275] -----EDYQDTAKWLLSHT-EQRPQVAVICGSGLGGLVNKLTQA-QTFDYSEIPNFPES------GRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS---G---E---NPLRGPNEERFGVRFPAMSDAYDRDMRQKA-HSTWKQMGEQR--E--L--QEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVI--------------MDY-E---SQ---GKA---NHEEVLEA-GKQAA--QKLEQFV-------
56 PsiBlast_CBE 87.8046% -94 - C4 - - 3PHB PNPH_HUMAN Y:[43-310] -----EDYKNTAEWLLSHT-KHRPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS---G---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRA-LSTWKQMGEQR--E--L--QEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITN-----------------KVI-M---DY---ESLEKANHEEVLAA-GKQAA--QKLEQFV-------
22 PsiBlast_CBE 87.7648% -97 - C4 - - 3FUC PNPH_BOVIN B:[8-275] -----EDYQDTAKWLLSHT-EQRPQVAVICGSGLGGLVNKLTQA-QTFDYSEIPNFP--------GRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS---G---E---NPLRGPNEERFGVRFPAMSDAYDRDMRQKA-HSTWKQMGEQR--E--L--QEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVI--------------MDY-E---SQ---GKA---NHEEVLEA-GKQAA--QKLEQFV-------
16 PsiBlast_PDB 87.6648% -94 - C4 - - 2AI2 PNPH_BOVIN A:[8-275] -----EDYQDTAKWLLSHT-EQRPQVAVICGSGLGGLVNKLTQA-QTFDYSEIPNFPES------GRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS---G---E---NPLRGPNEERFGVRFPAMSDAYDRDMRQKA-HSTWKQMGEQR--E--L--QEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVI--------------MDY-E---SQ---GKA---NHEEVLEA-GKQAA--QKLEQFV-------
21 PsiBlast_CBE 87.5648% -98 - C4 - - 3FUC PNPH_BOVIN C:[8-275] -----EDYQDTAKWLLSHT-EQRPQVAVICGSGLGGLVNKLTQA-QTFDYSEIPNFP--------GRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS---G---E---NPLRGPNEERFGVRFPAMSDAYDRDMRQKA-HSTWKQMGEQR--E--L--QEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVI--------------MDY-E---SQ---GKA---NHEEVLEA-GKQAA--QKLEQFV-------
14 PsiBlast_PDB 87.1848% -98 - C4 - - 3FUC PNPH_BOVIN A:[8-275] -----EDYQDTAKWLLSHT-EQRPQVAVICGSGLGGLVNKLTQA-QTFDYSEIPNFP--------GRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS---G---E---NPLRGPNEERFGVRFPAMSDAYDRDMRQKA-HSTWKQMGEQR--E--L--QEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVI--------------MDY-E---SQ---GKA---NHEEVLEA-GKQAA--QKLEQFV-------
18 PsiBlast_PDB 86.5248% -90 - C4 - - 1FXU PNPH_BOVIN A:[8-275] -----EDYQDTAKWLLSHT-EQRPQVAVICGSGLGGLVNKLTQA-QTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS---G---Q---NPLRGPNEERFGVRFPAMSDAYDRDMRQKA-HSTWKQMGEQR--E--L--QEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVI--------------MDT----------GKA---NHEEVLEA-GKQAA--QKLEQFV-------
45 PsiBlast_CBE 86.3046% -97 - C4 - - 1RSZ PNPH_HUMAN A:[8-275] -----EDYKNTAEWLLSHT-KHRPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS---G---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRA-LSTWKQMGEQR--E--L--QEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITN-----------------KVI-M---DY---ESLEKANHEEVLAA-GKQAA--QKLEQFV-------
47 PsiBlast_CBE 86.1446% -98 - C4 - - 1PF7 PNPH_HUMAN E:[8-275] -----EDYKNTAEWLLSHT-KHRPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS---G---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRA-LSTWKQMGEQR--E--L--QEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITN-----------------KVI-M---DY---ESLEKANHEEVLAA-GKQAA--QKLEQFV-------
44 PsiBlast_CBE 86.1346% -95 - C4 - - 1RT9 PNPH_HUMAN A:[8-275] -----EDYKNTAEWLLSHT-KHRPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS---G---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRA-LSTWKQMGEQR--E--L--QEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITN-----------------KVI-M---DY---ESLEKANHEEVLAA-GKQAA--QKLEQFV-------
46 PsiBlast_CBE 85.9946% -94 - C4 - - 1RR6 PNPH_HUMAN A:[8-275] -----EDYKNTAEWLLSHT-KHRPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS---G---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRA-LSTWKQMGEQR--E--L--QEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITN-----------------KVI-M---DY---ESLEKANHEEVLAA-GKQAA--QKLEQFV-------
50 PsiBlast_CBE 85.8546% -99 - C4 - - 1V3Q PNPH_HUMAN E:[7-274] -----EDYKNTAEWLLSHT-KHRPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS---G---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRA-LSTWKQMGEQR--E--L--QEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITN-----------------KVI-M---DY---ESLEKANHEEVLAA-GKQAA--QKLEQFV-------
53 PsiBlast_CBE 85.7746% -99 - C4 - - 1RCT PNPH_HUMAN E:[7-274] -----EDYKNTAEWLLSHT-KHRPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS---G---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRA-LSTWKQMGEQR--E--L--QEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITN-----------------KVI-M---DY---ESLEKANHEEVLAA-GKQAA--QKLEQFV-------
17 PsiBlast_PDB 85.6048% -98 - C4 - - 2AI3 PNPH_BOVIN A:[8-275] -----EDYQDTAKWLLSHT-EQRPQVAVICGSGLGGLVNKLTQA-QTFDYSEIPNFPES------GRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS---G---E---NPLRGPNEERFGVRFPAMSDAYDRDMRQKA-HSTWKQMGEQR--E--L--QEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVI--------------MDY-----------KA---NHEEVLEA-GKQAA--QKLEQFV-------
39 PsiBlast_CBE 85.4146% -95 - C4 - - 3BGS PNPH_HUMAN A:[8-275] -----EDYKNTAEWLLSHT-KHRPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS---G---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRA-LSTWKQMGEQR--E--L--QEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITN-----------------KVI-M---DY---ESLEKANHEEVLAA-GKQAA--QKLEQFV-------
52 PsiBlast_CBE 85.2346% -97 - C4 - - 1RFG PNPH_HUMAN E:[7-274] -----EDYKNTAEWLLSHT-KHRPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS---G---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRA-LSTWKQMGEQR--E--L--QEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITN-----------------KVI-M---DY---ESLEKANHEEVLAA-GKQAA--QKLEQFV-------
75 PsiBlast_CBE 85.1948% -93 - C4 - - 5CXS ? A:[28-284] ------------------------DIGIICGSGLGKLIEEIEER-KVIPYINIPNFPKTTVAGHVGNLVLGSVGGRKIVAMQGRLHMYEGYSNQEIALPIRVMKLLGVRVLLITNLAGGINRKLKSGDFVLIKGHIN---FP---GLGLN---NVLVGPNQDEFGPRFPDLSNAYDRLLQQLALKIAQENDF--Q--D--LV-HEGVYAFNGGPTYESPDESNMLLKLGCDVVGMSTVPEVIIACHCGIKVLAVSLIANNSI--------------LDA-E---ND---VSI---NHEKVLAV-AEKRA--DLLQMWFKEIITRL
114 HHSearch 85.1243% -96 - C4 - - 3KHS ? D:[2-279] --TDYDLAKETAAWLNKQL-QIRPVLGIVCGSGLGKIGDSLETS-ITVAYSDIPNFPVG-------SLIFGSVNGVSCVCMKGRFHLYEGHTAARATFPMRVFKALGVKIVVLTNAAGGLNPSYRPGDFMVVRDHIN---LPGLAG---A---NPLTGPNDDTEGERFPSMTSVYDKTLRKYA-ISAARELG--M--SYAT--HEGVYCCVNGPSFETPAECKILRLMGSDAVGMSTAPETIVAKHGGMRCLAVSLISN-----------------VIA-S---NCE---------------A-GEEAS--ARMTALVKLVIEKI
115 HHSearch 85.0243% -87 - C4 - - 3KHS ? B:[2-279] --TDYDLAKETAAWLNKQL-QIRPVLGIVCGSGLGKIGDSLETS-ITVAYSDIPNFPVG-----AGSLIFGSVNGVSCVCMKGRFHLYEGHTAARATFPMRVFKALGVKIVVLTNAAGGLNPSYRPGDFMVVRDHIN---LPGLAG---A---NPLTGPNDDTEGERFPSMTSVYDKTLRKYA-ISAARELG--M--SYAT--HEGVYCCVNGPSFETPAECKILRLMGSDAVGMSTAPETIVAKHGGMRCLAVSLISN-----------------VIA-S---NCE-----------EVLRA-GEEAS--ARMTALVKLVIEKI
40 PsiBlast_CBE 85.0146%-100 - C4 - - 2Q7O PNPH_HUMAN E:[8-275] -----EDYKNTAEWLLSHT-KHRPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS---G---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRA-LSTWKQMGEQR--E--L--QEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITN-----------------KVI-M---DY---ESLEKANHEEVLAA-GKQAA--QKLEQFV-------
30 PsiBlast_CBE 84.7446% -98 - C4 - - 3K8Q PNPH_HUMAN A:[8-275] -----EDYKNTAEWLLSHT-KHRPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS---G---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRA-LSTWKQMGEQR--E--L--QEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITN-----------------KVI-M---DY---ESLEKANHEEVLAA-GKQAA--QKLEQFV-------
48 PsiBlast_CBE 84.2946% -97 - C4 - - 1V45 PNPH_HUMAN E:[7-274] -----EDYKNTAEWLLSHT-KHRPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS---G---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRA-LSTWKQMGEQR--E--L--QEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITN-----------------KVI-M---DY---ESLEKANHEEVLAA-GKQAA--QKLEQFV-------
29 PsiBlast_CBE 84.2343%-100 - C4 - - 3KHS ? B:[5-273] -----DLAKETAAWLNKQL-QIRPVLGIVCGSGLGKIGDSLETS-ITVAYSDIPNFPVG-----AGSLIFGSVNGVSCVCMKGRFHLYEGHTAARATFPMRVFKALGVKIVVLTNAAGGLNPSYRPGDFMVVRDHINLPGLA---G---A---NPLTGPNDDTEGERFPSMTSVYDKTLRKYA-ISAARELG--M--S--YATHEGVYCCVNGPSFETPAECKILRLMGSDAVGMSTAPETIVAKHGGMRCLAVSLISN-----------------VIA-SNCE--------------EVLRA-GEEAS--ARMTALVK------
19 PsiBlast_PDB 83.9748% -99 - C4 - - 1VFN PNPH_BOVIN A:[5-272] -----EDYQDTAKWLLSHT-EQRPQVAVICGSGLGGLVNKLTQA-QTFDYSEIPNFPE-------GRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS---G---Q---NPLRGPNEERFGVRFPAMSDAYDRDMRQKA-HSTWKQMGEQR--E--L--QEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVI--------------MD------SQ---GKA---NHEEVLEA-GKQAA--QKLEQFV-------
72 PsiBlast_CBE 83.6947%-114 - C4 - - 2ON6 PNPH_HUMAN A:[8-275] -----EDYKNTAEWLLSHT-KHRPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRS----HAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS---G---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRA-LSTWKQMGEQR--E--L--QEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANFEEVLAA-G---KQ---AAQ---KLEQFV------------------------
28 PsiBlast_CBE 83.6743%-102 - C4 - - 3KHS ? C:[5-273] -----DLAKETAAWLNKQL-QIRPVLGIVCGSGLGKIGDSLETS-ITVAYSDIPNFPVGS----AGSLIFGSVNGVSCVCMKGRFHLYEGHTAARATFPMRVFKALGVKIVVLTNAAGGLNPSYRPGDFMVVRDHINLPGLA---G---A---NPLTGPNDDTEGERFPSMTSVYDKTLRKYA-ISAARELG--M--S--YATHEGVYCCVNGPSFETPAECKILRLMGSDAVGMSTAPETIVAKHGGMRCLAVSLISN-----------------VIA-SNCET-----------------A-GEEAS--ARMTALVK------
104 PsiBlast_CBE 83.4345% -86 - C4 - - 3FB1 ? A:[28-284] ------------------------EIGIICGSGLGKLADGVKDK-ITIPYTKIPNFPQTS---HSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIY---LP---GLGLN---NILVGPNQEAFGTRFPALSNAYDRDLRKLA-VQVAEENG--F--GNLV--HQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTN-----------------ISVLD---VE---SDLKP-NHEEVLATGAQRAELMQSWFEKIIEKL---
121 HHSearch 83.3342% -99 - C4 - - 1TCV ? A:[6-284] -TANIENVKKVAHHIQKLT-SIVPEIGIICGSGLGKLADGVKDK-ITIPYTKIPNFPQTS---HSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIY---LP---G---LGLNNILVGPNQEAFGTRFPALSNAYDRDLRKLA-VQVAEENG--FGNL--V--HQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTN-----------------ISV-L---DVESD---------------GAQRA--ELMQSWFEKIIEKL
27 PsiBlast_CBE 82.9443%-104 - C4 - - 3KHS ? D:[5-273] -----DLAKETAAWLNKQL-QIRPVLGIVCGSGLGKIGDSLETS-ITVAYSDIPNFPVG-------SLIFGSVNGVSCVCMKGRFHLYEGHTAARATFPMRVFKALGVKIVVLTNAAGGLNPSYRPGDFMVVRDHINLPGLA---G---A---NPLTGPNDDTEGERFPSMTSVYDKTLRKYA-ISAARELG--M--S--YATHEGVYCCVNGPSFETPAECKILRLMGSDAVGMSTAPETIVAKHGGMRCLAVSLISN-----------------VIA-SNCE------------------A-GEEAS--ARMTALVK------
105 PsiBlast_CBE 82.0545% -91 - C4 - - 3FAZ ? C:[28-284] ------------------------EIGIICGSGLGKLADGVKDK-ITIPYTKIPNFPQTSVVGHSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIY---LP---GLGLN---NILVGPNQEAFGTRFPALSNAYDRDLRKLA-VQVAEENG--F--GNLV--HQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTN-----------------ISVLD---VE---SDLKP-NHEEVLATGAQRAELMQSWFEKIIEKL---
102 PsiBlast_CBE 81.3945% -88 - C4 - - 3FB1 ? C:[28-284] ------------------------EIGIICGSGLGKLADGVKDK-ITIPYTKIPNFPQTSVVGHSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIY---LP---GLGLN---NILVGPNQEAFGTRFPALSNAYDRDLRKLA-VQVAEENG--F--GNLV--HQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTN-----------------ISVLD---VE---SDLKP-NHEEVLATGAQRAELMQSWFEKIIEKL---
125 HHSearch 77.6040% -59 - C4 - - 1G2O PUNA_MYCTU A:[7-268] --DPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQAELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLN---LT---A---R---SPLVG-------GEFVDLTDAYSPRLRELA-RQSD------P--Q--L--AEGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTN-----------------LAA-G---ITG--EPL---SHAEVLAA-GAASA--TRMGALLADVIARF
103 PsiBlast_CBE 77.0045% -91 - C4 - - 3FB1 ? B:[28-284] ------------------------EIGIICGSGLGKLADGVKDK-ITIPYTKIPNFPQT-VVGHSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIY---LP---GLGLN---NILVGPNQEAFGTRFPALSNAYDRDLRKLA-VQVAEENG--F--GNLV--HQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTN-----------------ISVLD---VE---S--------------AQRAELMQSWFEKIIEKL---