@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Q3XXS5: (2018-01-05 )
MSVHIEAKEGEIADKILLPGDPLRAKYIAETFLEDPVCYNQVRGMLGFTGKYKGERISVQGTGMGMPSATIYAHELIQSYGVKKLIRVGTCGALSKDVHVRDLVLAQGAATSSSMIEKNFQAFHFPPISDFNLLLKAYEIAKEKGYTVHVGNVLSEDSFYKDDLTETFQLAELGVLGVEMEAAALYYLGAKYHVQTLSLMTVSDHLITGEETTAAERQSTFNEMIEVGLETAIAE

Atome Classification :

(76 SA) .........10........20........30........40........50........60........70........80........90........100.......110.....-..120.......130.......140.......150.......160-.......170-.......180.......190.......200......-.210.....-..220.......230...
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) MSVHIEAKEGEIADKILLPGDPLRAKYIAETFLEDPVCYNQVRGMLGFTGKYKGERISVQGTGMGMPSATIYAHELIQSYGVKKLIRVGTCGALSKDVHVRDLVLAQGAATSSSMIE-KNFQAFHFPPISDFNLLLKAYEIAKEKGYTVHVGNVLSEDSFYKD-DLTETFQLAE-LGVLGVEMEAAALYYLGAKYHVQTLSLMTVSDHLIT-GEETTAAER-QSTFNEMIEVGLETAIAE
2 PsiBlast_PDB 95.4665%-109 - C2 - - 3UAW DEOD_BACCE A:[2-234] -SVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNR-LTFPGFDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRE-SMDMVKKLGD-YGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFT-GEETTSEER-QTTFNEMIEIALDAAIQ-
4 PsiBlast_PDB 94.8264%-113 - C2 - - 3UAZ DEOD_BACCE A:[2-234] -SVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNR-LTFPGFDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRE-SMDMVKKLGD-YGVLAVEMETTALYTLAAKYGVNALSVLTVSNHIFT-GEETTSEER-QTTFNEMIEIALDAAIQ-
3 PsiBlast_PDB 94.3264%-115 - C2 - - 3UAY DEOD_BACCE A:[2-234] -SVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNR-LTFPGFDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRE-SMDMVKKLGD-YGVLAVEMETTALYTLAAKYGVNALSVLTVSNHIFT-GEETTSEER-QTTFNEMIEIALDAAIQ-
32 PsiBlast_CBE 93.2560%-106 - C2 - - 4D8Y DEOD_BACSU E:[21-250] MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNR-VAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQIEKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLT-GEETTAEER-QTTFHDMIDVALHS----
1 PsiBlast_PDB 93.0965%-123 - C2 - - 2AC7 DEOD_BACAN A:[2-232] -SVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNR-LTFPGFDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRE-SMDMVKKLGD-YGVLAVEMETTALYTLAAKYGVNALSVLTVSDHI-------------QTTFNEMIEIALDAA---
142 HHSearch 92.9864% -98 - C2 - - 4TYM - ? A:[24-258] -SIHIEAKQGEIADKILLPGDPLRAKFIAENFLEDAVCFNTVRNMFGYTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKTLIRVGTAGAINPDIHVRELVLAQAAATNSNIIR-NDWPEFDFPQIADFKLLDKAYHIAKEMDITTHVGSVLSSDVFYSNQPD-RNMALGK-LGVHAIEMEAAALYYLAAQHNVNALAMMTISDNLNNPEEDTSAEER-QTTFTDMMKVGLETLISE
36 PsiBlast_CBE 92.7060%-105 - C2 - - 4D8V DEOD_BACSU B:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNR-VAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQIEKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLT-GEETTAEER-QTTFHDMIDVALHS----
31 PsiBlast_CBE 92.3560%-103 - C2 - - 4D8Y DEOD_BACSU F:[21-250] MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNR-VAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQIEKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLT-GEETTAEER-QTTFHDMIDVALHS----
33 PsiBlast_CBE 92.2260%-104 - C2 - - 4D8Y DEOD_BACSU D:[21-250] MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNR-VAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQIEKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLT-GEETTAEER-QTTFHDMIDVALHS----
35 PsiBlast_CBE 92.2060%-106 - C2 - - 4D8Y DEOD_BACSU B:[21-250] MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNR-VAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQIEKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLT-GEETTAEER-QTTFHDMIDVALHS----
15 PsiBlast_PDB 92.0860%-103 - C2 - - 4DAB DEOD_BACSU A:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNR-VAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQIEKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLT-GEETTAEER-QTTFHDMIDVALHS----
20 PsiBlast_PDB 92.0359%-119 - C2 - - 4M3N - ? A:[26-253] ---HISAPPGAVAEAILLPGDPLRAKYIAENFLENPVLYNQVRNMFGYTGTYKGKRVSVQGTGMGIPSASIYIHELVQFYGCKTLIRVGTAGAITERLKLRDLVIAQAACTDSSINN-LRFAGQNYAPIATFDLLRRAYEQAQSRGMPVHVGNVLSTDTFYHD-QPNPYQLWAQ-FGVLAVEMEAAGLYTLAAKFGVQALCILTISDHLIT-GEKTTPQER-QETFDQMIEVALET----
5 PsiBlast_PDB 91.9664%-112 - C2 - - 1XE3 - DEOD_BACAN A:[15-242] ----IEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNR-LTFPGFDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRE-SMDMVKKLGD-YGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFT-GEETTSEER-QTTFNEMIEIALDAA---
13 PsiBlast_PDB 91.8060%-103 - C2 - - 4DA7 DEOD_BACSU A:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNR-VAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQIEKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLT-GEETTAEER-QTTFHDMIDVALHS----
34 PsiBlast_CBE 91.6960%-105 - C2 - - 4D8Y DEOD_BACSU C:[21-250] MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNR-VAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQIEKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLT-GEETTAEER-QTTFHDMIDVALHS----
21 PsiBlast_CBE 91.5465%-121 - C2 - - 2AC7 DEOD_BACAN B:[2-232] -SVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNR-LTFPGFDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRE-SMDMVKKLGD-YGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIF------------QTTFNEMIEIALDAA---
10 PsiBlast_PDB 91.4960%-107 - C2 - - 4D9H DEOD_BACSU A:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNR-VAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQIEKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLT-GEETTAEER-QTTFHDMIDVALHS----
17 PsiBlast_PDB 91.4360%-106 - C2 - - 4DAN DEOD_BACSU A:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNR-VAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQIEKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLT-GEETTAEER-QTTFHDMIDVALHS----
16 PsiBlast_PDB 91.3860%-106 - C2 - - 4DAE DEOD_BACSU A:[21-250] MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNR-VAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQIEKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLT-GEETTAEER-QTTFHDMIDVALHS----
14 PsiBlast_PDB 91.3860%-106 - C2 - - 4DA8 DEOD_BACSU A:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNR-VAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQIEKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLT-GEETTAEER-QTTFHDMIDVALHS----
12 PsiBlast_PDB 91.2960%-105 - C2 - - 4DA6 DEOD_BACSU A:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNR-VAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQIEKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLT-GEETTAEER-QTTFHDMIDVALHS----
19 PsiBlast_PDB 90.4160%-111 - C2 - - 4DAR DEOD_BACSU A:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNR-VAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQIEKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLT-GEETTAEER-QTTFHDMIDVALHS----
6 PsiBlast_PDB 90.3460%-101 - C2 - - 4D8V DEOD_BACSU A:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNR-VAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQIEKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLT-GEETTAEER-QTTFHDMIDVALHS----
11 PsiBlast_PDB 90.0460%-105 - C2 - - 4DA0 DEOD_BACSU A:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNR-VAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQIEKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLT-GEETTAEER-QTTFHDMIDVALHS----
28 PsiBlast_CBE 89.4260%-107 - C2 - - 4DAN DEOD_BACSU B:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNR-VAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQIEKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLT-GEETTAEER-QTTFHDMIDVALHS----
139 HHSearch 89.1164% -91 - C2 - - 3UAW DEOD_BACCE A:[2-234] -SVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNR-LTFPGFDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMD-MVKKLGD-YGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGE--ETTSEERQTTFNEMIEIALDAAIQ-
18 PsiBlast_PDB 88.5960%-109 - C2 - - 4DAO DEOD_BACSU A:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNR-VAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQIEKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLT-GEETTAEER-QTTFHDMIDVALHS----
27 PsiBlast_CBE 88.4460%-102 - C2 - - 4DAO DEOD_BACSU B:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNR-VAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQIEKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLT-GEETTAEER-QTTFHDMIDVALHS----
120 PsiBlast_CBE 88.4253%-104 - C2 - - 1PK9 DEOD_ECO57 B:[4-233] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRT-HEQTTAAER-QTTFNDMIKIALESVL--
57 PsiBlast_CBE 88.3453%-104 - C2 - - 1PR4 DEOD_ECO57 B:[5-234] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRT-HEQTTAAER-QTTFNDMIKIALESVL--
60 PsiBlast_CBE 88.1353%-104 - C2 - - 1PR2 DEOD_ECO57 B:[5-234] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRT-HEQTTAAER-QTTFNDMIKIALESVL--
86 PsiBlast_CBE 87.8953%-100 - C2 - - 3UT6 DEOD_ECOLI C:[4-233] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRT-HEQTTAAER-QTTFNDMIKIALESVL--
135 PsiBlast_CBE 87.7453%-105 - C2 - - 1OTY DEOD_ECOLI B:[4-233] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRT-HEQTTAAER-QTTFNDMIKIALESVL--
63 PsiBlast_CBE 87.6053%-108 - C2 - - 1PR1 DEOD_ECO57 B:[5-234] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRT-HEQTTAAER-QTTFNDMIKIALESVL--
47 PsiBlast_CBE 87.0553%-104 - C2 - - 1PW7 DEOD_ECO57 C:[5-234] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRT-HEQTTAAER-QTTFNDMIKIALESVL--
121 PsiBlast_CBE 86.6653%-105 - C2 - - 1PK9 DEOD_ECO57 A:[4-233] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRT-HEQTTAAER-QTTFNDMIKIALESVL--
87 PsiBlast_CBE 86.4053%-100 - C2 - - 3UT6 DEOD_ECOLI B:[4-233] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRT-HEQTTAAER-QTTFNDMIKIALESVL--
118 PsiBlast_CBE 86.3853%-102 - C2 - - 1PKE DEOD_ECO57 A:[4-233] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRT-HEQTTAAER-QTTFNDMIKIALESVL--
51 PsiBlast_CBE 86.2853%-102 - C2 - - 1PR6 DEOD_ECO57 B:[5-234] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHI-----QTTAAER-QTTFNDMIKIALESVL--
131 PsiBlast_CBE 86.1853%-106 - C2 - - 1OU4 DEOD_ECOLI C:[4-233] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRT-HEQTTAAER-QTTFNDMIKIALESVL--
69 PsiBlast_CBE 86.0653%-104 - C2 - - 5IU6 DEOD_ECOLI B:[4-233] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRT-HEQTTAAER-QTTFNDMIKIALESVL--
132 PsiBlast_CBE 86.0253%-105 - C2 - - 1OU4 DEOD_ECOLI B:[4-233] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRT-HEQTTAAER-QTTFNDMIKIALESVL--
117 PsiBlast_CBE 85.9953%-105 - C2 - - 1PKE DEOD_ECO57 B:[4-233] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRT-HEQTTAAER-QTTFNDMIKIALESVL--
49 PsiBlast_CBE 85.9353%-102 - C2 - - 1PW7 DEOD_ECO57 A:[5-234] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRT-HEQTTAAER-QTTFNDMIKIALESVL--
122 PsiBlast_CBE 85.8753%-105 - C2 - - 1PK7 DEOD_ECO57 C:[4-233] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRT-HEQTTAAER-QTTFNDMIKIALESVL--
123 PsiBlast_CBE 85.8353%-105 - C2 - - 1PK7 DEOD_ECO57 B:[4-233] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRT-HEQTTAAER-QTTFNDMIKIALESVL--
70 PsiBlast_CBE 85.8153%-104 - C2 - - 5IU6 DEOD_ECOLI A:[4-233] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRT-HEQTTAAER-QTTFNDMIKIALESVL--
65 PsiBlast_CBE 85.8053% -99 - C2 - - 1PR0 DEOD_ECO57 C:[5-234] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRT-HEQTTAAER-QTTFNDMIKIALESVL--
133 PsiBlast_CBE 85.7653%-104 - C2 - - 1OU4 DEOD_ECOLI A:[4-233] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRT-HEQTTAAER-QTTFNDMIKIALESVL--
68 PsiBlast_CBE 85.5853%-102 - C2 - - 5IU6 DEOD_ECOLI C:[4-233] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRT-HEQTTAAER-QTTFNDMIKIALESVL--
137 PsiBlast_CBE 85.4753%-113 - C2 - - 1A69 DEOD_ECOLI C:[4-233] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIR-----TTAAER-QTTFNDMIKIALESVL--
124 PsiBlast_CBE 85.4153%-105 - C2 - - 1PK7 DEOD_ECO57 A:[4-233] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRT-HEQTTAAER-QTTFNDMIKIALESVL--
73 PsiBlast_CBE 85.3253%-103 - C2 - - 5I3C DEOD_ECOLI A:[4-233] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRT-HEQTTAAER-QTTFNDMIKIALESVL--
134 PsiBlast_CBE 85.1453% -99 - C2 - - 1OTY DEOD_ECOLI C:[4-233] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRT-HEQTTAAER-QTTFNDMIKIALESVL--
138 PsiBlast_CBE 85.1053%-105 - C2 - - 1A69 DEOD_ECOLI B:[4-233] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNR-IRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRT-HEQTTAAER-QTTFNDMIKIALESVL--