@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Q3XYZ7: (2018-01-11 )
MLKLPEDFIFGGATAAYQVEGATKEGGKGAVAWDDFLEEQGRFSPDPASDFYHQYAKDIELCERFGVNGLRLSIAWSRIFPDGAGKPNPEGIAFYHRVFEECKKRNVTPFVTLHHFDTPKRLFDHGDFLNRETIEAFVSYAIFCFHEFKEVKVWSTFNEIYPVATNQYLLGVFPPGIKYDFTKIVACLHNMMVAHARVVNYFKENELPGEIGVVHSLETKYAATDAPEDKHAAFLDDALSIRFLLDATYLGYYSTETLTALDEICEANQASYHFPEEDFVELKKASTRNDYLGINHYQCHFVKAYDGENAIHHNGTGEKGTSVYKVKGIGERIYKEGIPRTDWDWLIYPEGLYDLLLRIKSDYPHYNKIYITENGMGYKDQFEDGIIMDQPRIDYLRVYLESLSKAITAGVNVKGYFLWSLMDLFSWTNGYNKRYGLFYVDFETQKRYPKESAYWYKLVSETKTII

Atome Classification :

(42 SA) .........10........20........30........40---..-.----..----..---..50........60........70........80........90........100.......110.......120..-.....130.......140.......-150........160.......170.......180.......190.......200....-...-210.......220-.......230.-......240.......250.......260.......270.......280...--------....290.......300.--......310.......320...-....330.......340.......350.......360.......370.......380-...-....390.......400.......410.......420.......430.......440......---...450.......460....
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) MLKLPEDFIFGGATAAYQVEGATKEGGKGAVAWDDFLEEQ----GR-F----SP----DP---ASDFYHQYAKDIELCERFGVNGLRLSIAWSRIFPDGAGKPNPEGIAFYHRVFEECKKRNVTPFVTLHHFDTPKRLFD-HGDFLNRETIEAFVSYAIFCFHEFK-E-VKVWSTFNEIYPVATNQYLLGVFPPGIKYDFTKIVACLHNMMVAHARVVNYFKENE-LPG-EIGVVHSLETKYA-ATDAPEDKHAA-FLDDALSIRFLLDATYLGYYSTETLTALDEICEANQASYHFPEEDFVELKKA--------STRNDYLGINHYQCHFVK--AYDGENAIHHNGTGEKGTSVYK-VKGIGERIYKEGIPRTDWDWLIYPEGLYDLLLRIKSDYPHYNKIYITENGMGYKDQF-EDG-IIMDQPRIDYLRVYLESLSKAITAGVNVKGYFLWSLMDLFSWTNGYNKRYGLFYV--DFETQK---RYPKESAYWYKLVSETKTII
34 PsiBlast_PDB 98.9459% -44 - C4 - - 4PBG LACG_LACLL A:[5-467] ---LPKDFIFGGATAAYQAEGATHTDGKGPVAWDKYLEDN----YW-Y----TA----EP---ASDFYHKYPVDLELAEEYGVNGIRISIAWSRIFPTGYGEVNEKGVEFYHKLFAECHKRHVEPFVTLHHFDTPEALHS-NGDFLNRENIEHFIDYAAFCFEEFP-E-VNYWTTFNEIGPIGDGQYLVGKFPPGIKYDLAKVFQSHHNMMVSHARAVKLYKDKG-YKG-EIGVVHALPTKYPYDPENPADVRAA-ELEDIIHNKFILDATYLGHYSDKTMEGVNHILAENGGELDLRDEDFQALDAA--------KDLNDFLGINYYMSDWMQ--AFDGETEIIHNGKGEKGSSKYQ-IKGVGRRVAPDYVPRTDWDWIIYPEGLYDQIMRVKNDYPNYKKIYITCNGLGYKDEF-VDN-TVYDDGRIDYVKQHLEVLSDAIADGANVKGYFIWSLMDVFSWSNGYEKRYGLFYV--DFDTQE---RYPKKSAHWYKKLAETQVI-
33 PsiBlast_PDB 98.1059% -47 - C4 - - 2PBG - LACG_LACLL A:[5-467] ---LPKDFIFGGATAAYQAEGATHTDGKGPVAWDKYLEDN----YW-Y----TA----EP---ASDFYHKYPVDLELAEEYGVNGIRISIAWSRIFPTGYGEVNEKGVEFYHKLFAECHKRHVEPFVTLHHFDTPEALHS-NGDFLNRENIEHFIDYAAFCFEEFP-E-VNYWTTFNEIGPIGDGQYLVGKFPPGIKYDLAKVFQSHHNMMVSHARAVKLYKDKG-YKG-EIGVVHALPTKYPYDPENPADVRAA-ELEDIIHNKFILDATYLGHYCDKTMEGVNHILAENGGELDLRDEDFQALDAA--------KDLNDFLGINYYMSDWMQ--AFDGETEIIHNGKGEKGSSKYQ-IKGVGRRVAPDYVPRTDWDWIIYPEGLYDQIMRVKNDYPNYKKIYITENGLGYKDEF-VDN-TVYDDGRIDYVKQHLEVLSDAIADGANVKGYFIWSLMDVFSWSNGYEKRYGLFYV--DFDTQE---RYPKKSAHWYKKLAETQVI-
54 PsiBlast_CBE 97.9159% -42 - C4 - - 4PBG LACG_LACLL B:[5-467] ---LPKDFIFGGATAAYQAEGATHTDGKGPVAWDKYLEDN----YW-Y----TA----EP---ASDFYHKYPVDLELAEEYGVNGIRISIAWSRIFPTGYGEVNEKGVEFYHKLFAECHKRHVEPFVTLHHFDTPEALHS-NGDFLNRENIEHFIDYAAFCFEEFP-E-VNYWTTFNEIGPIGDGQYLVGKFPPGIKYDLAKVFQSHHNMMVSHARAVKLYKDKG-YKG-EIGVVHALPTKYPYDPENPADVRAA-ELEDIIHNKFILDATYLGHYSDKTMEGVNHILAENGGELDLRDEDFQALDAA--------KDLNDFLGINYYMSDWMQ--AFDGETEIIHNGKGEKGSSKYQ-IKGVGRRVAPDYVPRTDWDWIIYPEGLYDQIMRVKNDYPNYKKIYITCNGLGYKDEF-VDN-TVYDDGRIDYVKQHLEVLSDAIADGANVKGYFIWSLMDVFSWSNGYEKRYGLFYV--DFDTQE---RYPKKSAHWYKKLAETQVI-
32 PsiBlast_PDB 97.8059% -41 - C4 - - 3PBG - LACG_LACLL A:[5-467] ---LPKDFIFGGATAAYQAEGATHTDGKGPVAWDKYLEDN----YW-Y----TA----EP---ASDFYHKYPVDLELAEEYGVNGIRISIAWSRIFPTGYGEVNEKGVEFYHKLFAECHKRHVEPFVTLHHFDTPEALHS-NGDFLNRENIEHFIDYAAFCFEEFP-E-VNYWTTFNEIGPIGDGQYLVGKFPPGIKYDLAKVFQSHHNMMVSHARAVKLYKDKG-YKG-EIGVVHALPTKYPYDPENPADVRAA-ELEDIIHNKFILDATYLGHYSDKTMEGVNHILAENGGELDLRDEDFQALDAA--------KDLNDFLGINYYMSDWMQ--AFDGETEIIHNGKGEKGSSKYQ-IKGVGRRVAPDYVPRTDWDWIIYPEGLYDQIMRVKNDYPNYKKIYITENGLGYKDEF-VDN-TVYDDGRIDYVKQHLEVLSDAIADGANVKGYFIWSLMDVFSWSNGYEKRYGLFYV--DFDTQE---RYPKKSAHWYKKLAETQVI-
21 HHSearch 78.9236% -25 - C4 - - 1E4I BGLA_PAEPO A:[3-443] -FQFPQDFMWGTATAAYQIEGAYQEDGRGLSIWDTFAHTPGKVFNG-D----NG----NV---ACDSYHRYEEDIRLMKELGIRTYRFSVSWPRIFPNGDGEVNQKGLDYYHRVVDLLNDNGIEPFCTLYHWDLPQALQD-AGGWGNRRTIQAFVQFAETMFREFHGK-IQHWLTFNEPWCIAFLSNMLGVHAPGL-TNLQTAIDVGHHLLVAHGLSVRRFRELG--TSGQIGIAPNVSWAVP-YSTSEEDKAAC-ARTISLHSDWFLQPIYQGSYPQFLVDWFAEQ----GATVPIQDGDMDIIGE-----------PIDMIGINYYSMSVNR--FNPEAGFLQSE-----E--------------INMGLPVTDIGWPVESRGLYEVLHYLQ-KYGN-IDIYITENGACINDEV-VNG-KVQDDRRISYMQQHLVQVHRTIHDGLHVKGYMAWSLLDNFEWAEGYNMRFGMIHV--DFRTQV---RTPKQSYYWYRNVVSNNWL-
132 PsiBlast_CBE 78.7636% -21 - C4 - - 3WH8 ? A:[5-437] --RFPADFVWGAATAAYQIEGAVREDGRGVSIWDTFSHTP----GK-I----ADGTTGDV---ACDSYHRYGEDIGLLNALGMNAYRFSIAWPRIVPLGAGPINQAGLDHYSRMVDALLGAGLQPFVTLYHWDLPQPLED-RLGWGSRATATVFAEYADIVVRQLG-DRVTHWATLNEPWCSAMLGYYLGVHAPG-HTDLKRGLEASHNLLLGHGLAVQAMRAAAPQPL-QIGIVLNLTPTYP-ASDSPEDVAAA-RRFDGFVNRWFLDPLAGRGYPQDMLDYYGAAA---------PQ--PEDLTQI--------AAPLDWLGVNYYE--RMR--AVDAPDA-----------SLPQ-A----QRLDDPDLPHTA-DREVYPEGLYDILLRLHNDYP-FRPLYITENGCALHDEIAEDG-GIHDGQRQAFFEAHLAQLQRALAAGVPLKGYFAWSLLDNFEWAMGLSMRYGICYT--NFETLE---RRIKDSGYWLR---------
134 PsiBlast_CBE 77.2436% -22 - C4 - - 3WH6 ? A:[5-437] --RFPADFVWGAATAAYQIEGAVREDGRGVSIWDTFSHTP----GK-I----ADGTTGDV---ACDSYHRYGEDIGLLNALGMNAYRFSIAWPRIVPLGAGPINQAGLDHYSRMVDALLGAGLQPFVTLYHWDLPQPLED-RLGWGSRATATVFAEYADIVVRQLG-DRVTHWATLNEPWCSAMLGYYLGVHAPG-HTDLKRGLEASHNLLLGHGLAVQAMRAAAPQPL-QIGIVLNLTPTYP-ASDSPEDVAAA-RRFDGFVNRWFLDPLAGRGYPQDMLDYYGAAA---------PQANPEDLTQI--------AAPLDWLGVNYYE--RMR--AVDAPDA-----------SLPQ-A----QRLDDPDLPHTA-DREVYPEGLYDILLRLHNDYP-FRPLYITENGCALHDEIAEDG-GIHDGQRQAFFEAHLAQLQRALAAGVPLKGYFAWSLLDNFEWAMGLSMRYGICYT--NFETLE---RRIKDSGYWLR---------
133 PsiBlast_CBE 77.1036% -20 - C4 - - 3WH7 ? A:[5-437] --RFPADFVWGAATAAYQIEGAVREDGRGVSIWDTFSHTP----GK-I----ADGTTGDV---ACDSYHRYGEDIGLLNALGMNAYRFSIAWPRIVPLGAGPINQAGLDHYSRMVDALLGAGLQPFVTLYHWDLPQPLED-RLGWGSRATATVFAEYADIVVRQLG-DRVTHWATLNEPWCSAMLGYYLGVHAPG-HTDLKRGLEASHNLLLGHGLAVQAMRAAAPQPL-QIGIVLNLTPTYP-ASDSPEDVAAA-RRFDGFVNRWFLDPLAGRGYPQDMLDYYGAAA---------PQANPEDLTQI--------AAPLDWLGVNYYE--RMR--AVDAPDA-----------SLPQ-A----QRLDDPDLPHTA-DREVYPEGLYDILLRLHNDYP-FRPLYITENGCALHDEIAEDG-GIHDGQRQAFFEAHLAQLQRALAAGVPLKGYFAWSLLDNFEWAMGLSMRYGICYT--NFETLE---RRIKDSGYWLR---------
136 PsiBlast_CBE 76.7236% -20 - C4 - - 5AYB ? A:[5-437] --RFPADFVWGAATAAYQIEGAVREDGRGVSIWDTFSHTP----GK-I----ADGTTGDV---ACDSYHRYGEDIGLLNALGMNAYRFSIAWPRIVPLGAGPINQAGLDHYSRMVDALLGAGLQPFVTLYHWDLPQPLED-RLGWGSRATATVFAEYADIVVRQLG-DRVTHWATLNEPWCSAMLGYYLGVHAPG-HTDLKRGLEASHNLLLGHGLAVQAMRAAAPQPL-QIGIVLGLTPTYP-ASDSPEDVAAA-RRFDGFVNRWFLDPLAGRGYPQDMLDYYGAAA---------PQANPEDLTQI--------AAPLDWLGVNYYE--RMR--AVDAPDA-----------SLPQ-A----QRLDDPDLPHTA-DREVYPEGLYDILLRLHNDYP-FRPLYITENGCALHDEIAEDG-GIHDGQRQAFFEAHLAQLQRALAAGVPLKGYFAWSLLDNFEWAMGLSMRYGICYT--NFETLE---RRIKDSGYWLR---------
18 HHSearch 76.2936% -15 - C4 - - 5DT7 ? D:[24-465] -MKFAPNFVFGTATSSYQIEGAHDEGGRTPSIWDTFCDTDGKVFEK-H----NG----DV---ACDHYHRFEEDIQHIKQLGVDTYRFSIAWPRIFPSK-GQFNPEGMAFYKTLATRLQEEGIKPAVTLYHWDLPMWAHE-EGGWVNRDSVDWFLDFARVCFEELDGI-VDSWITHNEPWCAGFLSYHLGQHAPGH-TDMNEAVRAVHHMLLSHGKAVEMLKGEF-NSATPIGITLNLAPKYA-KTDSINDQIAM-NNADGYANRWFLDPIFKGQYPVDMMNLFSKYV--HTY-DFIHAGDLATIST-----------PCDFFGINFYSRNLVE--FSAASDFLHK------D--------------AYSDYDKTGMGWDIAPSEFKDLIRRLRAEYTD-LPIYITENGAAFDDQL-VDG-KIHDQNRIDYVAQHLQAVSDLNDEGMNIAGYYLWSLLDNFEWSFGYDKRFGIIYV--DFDTQE---RIWKDSAHWYANVIQTHKA-
135 PsiBlast_CBE 76.1736% -20 - C4 - - 3WH5 ? A:[5-437] --RFPADFVWGAATAAYQIEGAVREDGRGVSIWDTFSHTP----GK-I----ADGTTGDV---ACDSYHRYGEDIGLLNALGMNAYRFSIAWPRIVPLGAGPINQAGLDHYSRMVDALLGAGLQPFVTLYHWDLPQPLED-RLGWGSRATATVFAEYADIVVRQLG-DRVTHWATLNEPWCSAMLGYYLGVHAPG-HTDLKRGLEASHNLLLGHGLAVQAMRAAAPQPL-QIGIVLNLTPTYP-ASDSPEDVAAA-RRFDGFVNRWFLDPLAGRGYPQDMLDYYGAAA---------PQANPEDLTQI--------AAPLDWLGVNYYE--RMR--AVDAPDA-----------SLPQ-A----QRLDDPDLPHTA-DREVYPEGLYDILLRLHNDYP-FRPLYITENGCALHDEIAEDG-GIHDGQRQAFFEAHLAQLQRALAAGVPLKGYFAWSLLDNFEWAMGLSMRYGICYT--NFETLE---RRIKDSGYWLR---------
137 PsiBlast_CBE 75.8536% -19 - C4 - - 5AYI ? A:[5-437] --RFPADFVWGAATAAYQIEGAVREDGRGVSIWDTFSHTP----GK-I----ADGTTGDV---ACDSYHRYGEDIGLLNALGMNAYRFSIAWPRIVPLGAGPINQAGLDHYSRMVDALLGAGLQPFVTLYHWDLPQPLED-RLGWGSRATATVFAEYADIVVRQLG-DRVTHWATLNEPWCSAMLGYYLGVHAPG-HTDLKRGLEASHNLLLGHGLAVQAMRAAAPQPL-QIGIVLQLTPTYP-ASDSPEDVAAA-RRFDGFVNRWFLDPLAGRGYPQDMLDYYGAAA---------PQANPEDLTQI--------AAPLDWLGVNYYE--RMR--AVDAPDA-----------SLPQ-A----QRLDDPDLPHTA-DREVYPEGLYDILLRLHNDYP-FRPLYITENGCALHDEIAEDG-GIHDGQRQAFFEAHLAQLQRALAAGVPLKGYFAWSLLDNFEWAMGLSMRYGICYT--NFETLE---RRIKDSGYWLR---------
56 PsiBlast_CBE 75.4039% -14 - C4 - - 3AHX ? C:[4-441] -LRFPKDFIFGTATAAYQIEGAYKEDEKGESIWDRFSHIP----GN-V----AKMHNGDI---ACDHYHRYKEDVQLLKSLGIKSYRFSIAWPRIFPKGFGEINQKGIQFYRDLIDELIKNDIEPAITIYHWDLPQKLQD-IGGWANPQVADYYVDYANLLFREFG-DRVKTWITHNEPWVASYLGYALGVHAPGIK-DMKMALLAAHNILLSHFKAVKAYRELE-QDG-QIGITLNLSTCYS-NSADEEDIAAA-HRSDGWNNRWFLDAALKGTYPEDMI----KIFSDTNIMPELPKELFTEVFET--------S---DFLGINYYTRQVVK----NNSEAF------------------IGAESVAMDNPKTEMGWEIYPQGLYDLLTRIHRDYGNID-LYITENGAAFNDMVNRDG-KVEDENRLDYLYTHFAAALSAIEAGVPLKGYYIWSFMDNFEWAEGYEKRFGIVHV--NYKTQE---RTIKKSAYWYKELIE-----
141 PsiBlast_CBE 75.0935% -20 - C4 - - 1BGG BGLA_PAEPO B:[3-438] IFQFPQDFMWGTATAAYQIEGAYQEDGRGLSIWDTFAHTP----GKVF----NG----DNGNVACDSYHRYEEDIRLMKELGIRTYRFSVSWPRIFPNGDGEVNQEGLDYYHRVVDLLNDNGIEPFCTLYHWDLPQALQD-AGGWGNRRTIQAFVQFAETMFREFHGK-IQHWLTFNEPWCIAFLSNMLGVHAPGLT-NLQTAIDVGHHLLVAHGLSVRRFRELG-TSG-QIGIAPNVSWAVP-YSTSEEDKAAC-ARTISLHSDWFLQPIYQGSYPQ---FLVDWFAEQGAT---VPIQD-GDMDII--------GEPIDMIGINYYSMS-VN--RFNPEAGFLQS-----------------EEI-NMGLPVTDIGWPVESRGLYEVLHYLQK-YGNID-IYITENGACINDEV-VNG-KVQDDRRISYMQQHLVQVHRTIHDGLHVKGYMAWSLLDNFEWAEGYNMRFGMIHV--DFRTQV---RTPKESYYWYRNV-------
139 PsiBlast_CBE 75.0535% -19 - C4 - - 1BGG BGLA_PAEPO D:[3-438] IFQFPQDFMWGTATAAYQIEGAYQEDGRGLSIWDTFAHTP----GKVF----NG----DNGNVACDSYHRYEEDIRLMKELGIRTYRFSVSWPRIFPNGDGEVNQEGLDYYHRVVDLLNDNGIEPFCTLYHWDLPQALQD-AGGWGNRRTIQAFVQFAETMFREFHGK-IQHWLTFNEPWCIAFLSNMLGVHAPGLT-NLQTAIDVGHHLLVAHGLSVRRFRELG-TSG-QIGIAPNVSWAVP-YSTSEEDKAAC-ARTISLHSDWFLQPIYQGSYPQ---FLVDWFAEQGAT---VPIQD-GDMDII--------GEPIDMIGINYYSMS-VN--RFNPEAGFLQS-----------------EEI-NMGLPVTDIGWPVESRGLYEVLHYLQK-YGNID-IYITENGACINDEV-VNG-KVQDDRRISYMQQHLVQVHRTIHDGLHVKGYMAWSLLDNFEWAEGYNMRFGMIHV--DFRTQV---RTPKESYYWYRNV-------
57 PsiBlast_CBE 75.0139% -14 - C4 - - 3AHX ? B:[4-441] -LRFPKDFIFGTATAAYQIEGAYKEDEKGESIWDRFSHIP----GN-V----AKMHNGDI---ACDHYHRYKEDVQLLKSLGIKSYRFSIAWPRIFPKGFGEINQKGIQFYRDLIDELIKNDIEPAITIYHWDLPQKLQD-IGGWANPQVADYYVDYANLLFREFG-DRVKTWITHNEPWVASYLGYALGVHAPGIK-DMKMALLAAHNILLSHFKAVKAYRELE-QDG-QIGITLNLSTCYS-NSADEEDIAAA-HRSDGWNNRWFLDAALKGTYPEDMI----KIFSDTNIMPELPKELFTEVFET--------S---DFLGINYYTRQVVK----NNSEAF------------------IGAESVAMDNPKTEMGWEIYPQGLYDLLTRIHRDYGNID-LYITENGAAFNDMVNRDG-KVEDENRLDYLYTHFAAALSAIEAGVPLKGYYIWSFMDNFEWAEGYEKRFGIVHV--NYKTQE---RTIKKSAYWYKELIE-----
138 PsiBlast_CBE 74.9935% -19 - C4 - - 1UYQ BGLA_PAEPO A:[2-437] IFQFPQDFMWGTATAAYQIEGAYQEDGRGLSIWDTFAHTP----GKVF----NG----DNGNVACDSYHRYEEDIRLMKELGIRTYRFSVSWPRIFPNGDGEVNQEGLDYYHRVVDLLNDNGIEPFCTLYHWDLPQALQD-AGGWGNRRTIQAFVQFAETMFREFHGK-IQHWLTFNEPWCIAFLSNMLGVHAPGLT-NLQTAIDVGHHLLVAHGLSVRRFRELG-TSG-QIGIAPNVSWAVP-YSTSEEDKAAC-ARTISLHSDWFLQPIYQGSYPQ---FLVDWFAEQGAT---VPIQD-GDMDII--------GEPIDMIGINYYSMS-VN--RFNPEAGFLQS-----------------EEI-NMGLPVTDIGWPVESRGLYEVLHYLQK-YGNID-IYITENGACINDEV-VNG-KVQDDRRISYMQQHLVQVHRAIHDGLHVKGYMAWSLLDNFEWAEGYNMRFGMIHV--DFRTQV---RTPKQSYYWYRNV-------
100 PsiBlast_CBE 74.9835% -11 - C4 - - 2J78 BGLA_THEMA B:[27-466] --KFPEGFLWGVATASYQIEGSPLADGAGMSIWHTFSHTP----GN-VKNGDTG----DV---ACDHYNRWKEDIEIIEKLGVKAYRFSISWPRILPEGTGRVNQKGLDFYNRIIDTLLEKGITPFVTIYHWDLPFALQL-KGGWANREIADWFAEYSRVLFENFG-DRVKNWITLNEPWVVAIVGHLYGVHAPGMR-DIYVAFRAVHNLLRAHARAVKVFRETV-KDG-KIGIVFNNGYFEP-ASEKEEDIRAVRFMHQFNNYPLFLNPIYRGDYPELVLEFARE---------YLPENYKDDMSEI--------QEKIDFVGLNYYSGHLVK---FDPD-------------A-AK-VSFV-----ERDLPKTAMGWEIVPEGIYWILKKVKEEY-NPPEVYITENGAAFDDVVSEDG-RVHDQNRIDYLKAHIGQAWKAIQEGVPLKGYFVWSLLDNFEWAEGYSKRFGIVYV--DYSTQK---RIVKDSGYWYSNVVKNNGL-
45 PsiBlast_PDB 74.7835% -9 - C4 - - 1OIM BGLA_THEMA A:[27-466] --KFPEGFLWGVATASYQIEGSPLADGAGMSIWHTFSHTP----GN-VKNGDTG----DV---ACDHYNRWKEDIEIIEKLGVKAYRFSISWPRILPEGTGRVNQKGLDFYNRIIDTLLEKGITPFVTIYHWDLPFALQL-KGGWANREIADWFAEYSRVLFENFG-DRVKNWITLNEPWVVAIVGHLYGVHAPGMR-DIYVAFRAVHNLLRAHARAVKVFRETV-KDG-KIGIVFNNGYFEP-ASEKE-DIRAVRFMHQFNNYPLFLNPIYRGDYPELVLEFARE---------YLPENYKDDMSEI--------QEKIDFVGLNYYSGHLVK---FDPD-------------APAK-VSFV-----ERDLPKTAMGWEIVPEGIYWILKKVKEEY-NPPEVYITENGAAFDDVVSEDG-RVHDQNRIDYLKAHIGQAWKAIQEGVPLKGYFVWSLLDNFEWAEGYSKRFGIVYV--DYSTQK---RIVKDSGYWYSNVVKNNGL-
55 PsiBlast_CBE 74.6839% -11 - C4 - - 3AHX ? D:[4-441] -LRFPKDFIFGTATAAYQIEGAYKEDEKGESIWDRFSHIP----GN-V----AKMHNGDI---ACDHYHRYKEDVQLLKSLGIKSYRFSIAWPRIFPKGFGEINQKGIQFYRDLIDELIKNDIEPAITIYHWDLPQKLQD-IGGWANPQVADYYVDYANLLFREFG-DRVKTWITHNEPWVASYLGYALGVHAPGIK-DMKMALLAAHNILLSHFKAVKAYRELE-QDG-QIGITLNLSTCYS-NSADEEDIAAA-HRSDGWNNRWFLDAALKGTYPEDMI----KIFSDTNIMPELPKELFTEVFET--------S---DFLGINYYTRQVVK----NNSEAF------------------IGAESVAMDNPKTEMGWEIYPQGLYDLLTRIHRDYGNID-LYITENGAAFNDMVNRDG-KVEDENRLDYLYTHFAAALSAIEAGVPLKGYYIWSFMDNFEWAEGYEKRFGIVHV--NYKTQE---RTIKKSAYWYKELIE-----
44 PsiBlast_PDB 74.4235% -8 - C4 - - 1OIF BGLA_THEMA A:[27-466] --KFPEGFLWGVATASYQIEGSPLADGAGMSIWHTFSHTP----GN-VKNGDTG----DV---ACDHYNRWKEDIEIIEKLGVKAYRFSISWPRILPEGTGRVNQKGLDFYNRIIDTLLEKGITPFVTIYHWDLPFALQL-KGGWANREIADWFAEYSRVLFENFG-DRVKNWITLNEPWVVAIVGHLYGVHAPGMR-DIYVAFRAVHNLLRAHARAVKVFRETV-KDG-KIGIVFNNGYFEP-ASEKEEDIRAVRFMHQFNNYPLFLNPIYRGDYPELVLEFARE---------YLPENYKDDMSEI--------QEKIDFVGLNYYSGHLVK---FDPD-------------APAK-VSFV-----ERDLPKTAMGWEIVPEGIYWILKKVKEEY-NPPEVYITENGAAFDDVVSEDG-RVHDQNRIDYLKAHIGQAWKAIQEGVPLKGYFVWSLLDNFEWAEGYSKRFGIVYV--DYSTQK---RIVKDSGYWYSNVVKNNGL-
111 PsiBlast_CBE 74.1035% -7 - C4 - - 1OIN BGLA_THEMA B:[27-466] --KFPEGFLWGVATASYQIEGSPLADGAGMSIWHTFSHTP----GN-VKNGDTG----DV---ACDHYNRWKEDIEIIEKLGVKAYRFSISWPRILPEGTGRVNQKGLDFYNRIIDTLLEKGITPFVTIYHWDLPFALQL-KGGWANREIADWFAEYSRVLFENFG-DRVKNWITLNEPWVVAIVGHLYGVHAPGMR-DIYVAFRAVHNLLRAHARAVKVFRETV--DG-KIGIVFNNGYFEP-ASEKEEDIRAVRFMHQFNNYPLFLNPIYRGDYPELVLEFARE---------YLPENYKDDMSEI--------QEKIDFVGLNYYSGHLVK---FDPD-------------APAK-VSFV-----ERDLPKTAMGWEIVPEGIYWILKKVKEEY-NPPEVYITENGAAFDDVVSEDG-RVHDQNRIDYLKAHIGQAWKAIQEGVPLKGYFVWSLLDNFEWAEGYSKRFGIVYV--DYSTQK---RIVKDSGYWYSNVVKNNGL-
108 PsiBlast_CBE 73.8135% -9 - C4 - - 2CBU BGLA_THEMA B:[27-466] --KFPEGFLWGVATASYQIEGSPLADGAGMSIWHTFSHTP----GN-VKNGDTG----DV---ACDHYNRWKEDIEIIEKLGVKAYRFSISWPRILPEGTGRVNQKGLDFYNRIIDTLLEKGITPFVTIYHWDLPFALQL-KGGWANREIADWFAEYSRVLFENFG-DRVKNWITLNEPWVVAIVGHLYGVHAPGMR-DIYVAFRAVHNLLRAHARAVKVFRETV-KDG-KIGIVFNNGYFEP-ASEKEEDIRAVRFMHQFNNYPLFLNPIYRGDYPELVLEFARE---------YLPENYKDDMSEI--------QEKIDFVGLNYYSGHLVK---FDPD-------------A--K-VSFV-----ERDLPKTAMGWEIVPEGIYWILKKVKEEY-NPPEVYITENGAAFDDVVSEDG-RVHDQNRIDYLKAHIGQAWKAIQEGVPLKGYFVWSLLDNFEWAEGYSKRFGIVYV--DYSTQK---RIVKDSGYWYSNVVKNNGL-
50 PsiBlast_PDB 73.7635% -9 - C4 - - 2CBV BGLA_THEMA A:[27-466] --KFPEGFLWGVATASYQIEGSPLADGAGMSIWHTFSHTP----GN-VKNGDTG----DV---ACDHYNRWKEDIEIIEKLGVKAYRFSISWPRILPEGTGRVNQKGLDFYNRIIDTLLEKGITPFVTIYHWDLPFALQL-KGGWANREIADWFAEYSRVLFENFG-DRVKNWITLNEPWVVAIVGHLYGVHAPGMR-DIYVAFRAVHNLLRAHARAVKVFRETV-KDG-KIGIVFNNGYFEP-ASEKE-DIRAVRFMHQFNNYPLFLNPIYRGDYPELVLEFARE---------YLPENYKDDMSEI--------QEKIDFVGLNYYSGHLVK---FDPD-------------APAK-VSFV-----ERDLPKTAMGWEIVPEGIYWILKKVKEEY-NPPEVYITENGAAFDDVVSEDG-RVHDQNRIDYLKAHIGQAWKAIQEGVPLKGYFVWSLLDNFEWAEGYSKRFGIVYV--DYSTQK---RIVKDSGYWYSNVVKNNGL-
104 PsiBlast_CBE 73.5835% -10 - C4 - - 2J75 BGLA_THEMA A:[27-466] --KFPEGFLWGVATASYQIEGSPLADGAGMSIWHTFSHTP----GN-VKNGDTG----DV---ACDHYNRWKEDIEIIEKLGVKAYRFSISWPRILPEGTGRVNQKGLDFYNRIIDTLLEKGITPFVTIYHWDLPFALQL-KGGWANREIADWFAEYSRVLFENFG-DRVKNWITLNEPWVVAIVGHLYGVHAPGMR-DIYVAFRAVHNLLRAHARAVKVFRETV-KDG-KIGIVFNNGYFEP-AS---EDIRAVRFMHQFNNYPLFLNPIYRGDYPELVLEFARE---------YLPENYKDDMSEI--------QEKIDFVGLNYYSGHLVK---FD---------------APAK-VSFV-----ERDLPKTAMGWEIVPEGIYWILKKVKEEY-NPPEVYITENGAAFDDVVSEDG-RVHDQNRIDYLKAHIGQAWKAIQEGVPLKGYFVWSLLDNFEWAEGYSKRFGIVYV--DYSTQK---RIVKDSGYWYSNVVKNNGL-
72 PsiBlast_CBE 73.5335% -9 - C4 - - 5N6T ? A:[27-466] --KFPEGFLWGVATASYQIEGSPLADGAGMSIWHTFSHTP----GN-VKNGDTG----DV---ACDHYNRWKEDIEIIEKLGVKAYRFSISWPRILPEGTGRVNQKGLDFYNRIIDTLLEKGITPFVTIYHWDLPFALQL-KGGWANREIADWFAEYSRVLFENFG-DRVKNWITLNEPWVVAIVGHLYGVHAPGMR-DIYVAFRAVHNLLRAHARAVKVFRETV-KDG-KIGIVFNNGYFEP-ASEKEEDIRAVRFMHQFNNYPLFLNPIYRGDYPELVLEFARE---------YLPENYKDDMSEI--------QEKIDFVGLNYYSGHLVK---FDPD-------------APAK-VSFV-----ERDLPKTAMGWEIVPEGIYWILKKVKEEY-NPPEVYITENGAAFDDVVSEDG-RVHDQNRIDYLKAHIGQAWKAIQEGVPLKGYFVWSLLDNFEWAEGYSKRFGIVYV--DYSTQK---RIVKDSGYWYSNVVKNNGL-
109 PsiBlast_CBE 73.4735% -9 - C4 - - 1W3J BGLA_THEMA B:[27-466] --KFPEGFLWGVATASYQIEGSPLADGAGMSIWHTFSHTP----GN-VKNGDTG----DV---ACDHYNRWKEDIEIIEKLGVKAYRFSISWPRILPEGTGRVNQKGLDFYNRIIDTLLEKGITPFVTIYHWDLPFALQL-KGGWANREIADWFAEYSRVLFENFG-DRVKNWITLNEPWVVAIVGHLYGVHAPGMR-DIYVAFRAVHNLLRAHARAVKVFRETV--DG-KIGIVFNNGYFEP-ASEKEEDIRAVRFMHQFNNYPLFLNPIYRGDYPELVLEFARE---------YLPENYKDDMSEI--------QEKIDFVGLNYYSGHLVK---FDPD-------------A-AK-VSFV-----ERDLPKTAMGWEIVPEGIYWILKKVKEEY-NPPEVYITENGAAFDDVVSEDG-RVHDQNRIDYLKAHIGQAWKAIQEGVPLKGYFVWSLLDNFEWAEGYSKRFGIVYV--DYSTQK---RIVKDSGYWYSNVVKNNGL-
110 PsiBlast_CBE 73.2035% -5 - C4 - - 1UZ1 BGLA_THEMA B:[27-466] --KFPEGFLWGVATASYQIEGSPLADGAGMSIWHTFSHTP----GN-VKNGDTG----DV---ACDHYNRWKEDIEIIEKLGVKAYRFSISWPRILPEGTGRVNQKGLDFYNRIIDTLLEKGITPFVTIYHWDLPFALQL-KGGWANREIADWFAEYSRVLFENFG-DRVKNWITLNEPWVVAIVGHLYGVHAPGMR-DIYVAFRAVHNLLRAHARAVKVFRETV--DG-KIGIVFNNGYFEP-ASEKEEDIRAVRFMHQFNNYPLFLNPIYRGDYPELVLEFARE---------YLPENYKDDMSEI--------QEKIDFVGLNYYSGHLVK---FDPD-------------A--K-VSFV-----ERDLPKTAMGWEIVPEGIYWILKKVKEEY-NPPEVYITENGAAFDDVVSEDG-RVHDQNRIDYLKAHIGQAWKAIQEGVPLKGYFVWSLLDNFEWAEGYSKRFGIVYV--DYSTQK---RIVKDSGYWYSNVVKNNGL-
113 PsiBlast_CBE 73.1235% -7 - C4 - - 1OIF BGLA_THEMA B:[27-466] --KFPEGFLWGVATASYQIEGSPLADGAGMSIWHTFSHTP----GN-VKNGDTG----DV---ACDHYNRWKEDIEIIEKLGVKAYRFSISWPRILPEGTGRVNQKGLDFYNRIIDTLLEKGITPFVTIYHWDLPFALQL-KGGWANREIADWFAEYSRVLFENFG-DRVKNWITLNEPWVVAIVGHLYGVHAPGMR-DIYVAFRAVHNLLRAHARAVKVFRETV--DG-KIGIVFNNGYFEP-ASEKEEDIRAVRFMHQFNNYPLFLNPIYRGDYPELVLEFARE---------YLPENYKDDMSEI--------QEKIDFVGLNYYSGHLVK---FDPD-------------A-AK-VSFV-----ERDLPKTAMGWEIVPEGIYWILKKVKEEY-NPPEVYITENGAAFDDVVSEDG-RVHDQNRIDYLKAHIGQAWKAIQEGVPLKGYFVWSLLDNFEWAEGYSKRFGIVYV--DYSTQK---RIVKDSGYWYSNVVKNNGL-
46 PsiBlast_PDB 73.1035% -8 - C4 - - 1OIN BGLA_THEMA A:[27-466] --KFPEGFLWGVATASYQIEGSPLADGAGMSIWHTFSHTP----GN-VKNGDTG----DV---ACDHYNRWKEDIEIIEKLGVKAYRFSISWPRILPEGTGRVNQKGLDFYNRIIDTLLEKGITPFVTIYHWDLPFALQL-KGGWANREIADWFAEYSRVLFENFG-DRVKNWITLNEPWVVAIVGHLYGVHAPGMR-DIYVAFRAVHNLLRAHARAVKVFRETV-KDG-KIGIVFNNGYFEP-ASEKEEDIRAVRFMHQFNNYPLFLNPIYRGDYPELVLEFARE---------YLPENYKDDMSEI--------QEKIDFVGLNYYSGHLVK---FDP---------------PAK-VSFV-----ERDLPKTAMGWEIVPEGIYWILKKVKEEY-NPPEVYITENGAAFDDVVSEDG-RVHDQNRIDYLKAHIGQAWKAIQEGVPLKGYFVWSLLDNFEWAEGYSKRFGIVYV--DYSTQK---RIVKDSGYWYSNVVKNNGL-