@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Q3XZ28: (2018-01-12 )
MVRVKGLNIGSGRPKICAPLIGAVREEVLREAVLAREAGADLVEWRVDHYREVFSFDEVAETLVLIHEMLDGLPLLFTFRTLAEGGEQDISIRQYRDLYEHVIHTGLVDMVDIELFKVESLGKRLIEEIKSLNIPLIISSHDFKETPADPVLLYRLNVMEHFGADIGKLAVTPNNERDVLRLMELTRRANAFVSMPIITMSMGNLGKISRLVGGTTGSVMTFGSLSSDSTSAPGQLPVKALKQIIQLLNEPL

Atome Classification :

(55 SA) --.........10........20........30........40........50........60.......-.70........80........90........100-.....-..110.......120.......130----.......140.......150.......160.......170.......180....-...-190-........200.......210.......220.......230.......240.......250
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) --MVRVKGLNIGSGRPKICAPLIGAVREEVLREAVLAREAGADLVEWRVDHYREVFSFDEVAETLVLIHE-MLDGLPLLFTFRTLAEGGEQDISIRQYRDLYEHV-IHTGL-VDMVDIELFKVESLGKRLIEEIKSL----NIPLIISSHDFKETPADPVLLYRLNVMEHFGADIGKLAVTPNNERDVLRLMELT-RRA-N-A-FVSMPIITMSMGNLGKISRLVGGTTGSVMTFGSLSSDSTSAPGQLPVKALKQIIQLLNEPL
6 PsiBlast_PDB 86.8742% -92 - C5 - - 4GUI AROD_SALTY A:[7-254] ---VTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIRE-IITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAA-VDSGL-VDMIDLELFTGDDEVKATVGYAHQH----NVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQ-E-R-YADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK--KASAPGQISVADLRTVLTILHQ--
45 PsiBlast_CBE 86.8341% -92 - C5 - - 3NNT AROD_SALTY B:[28-275] ---VTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIRE-IITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAA-VDSGL-VDMIDLELFTGDDEVKATVGYAHQH----NVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPMIAVMPQTKADVLTLLTATVEMQ-E-R-YADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK--KASAPGQISVADLRTVLTILHQ--
38 PsiBlast_CBE 86.6442% -89 - C5 - - 3S42 AROD_SALTY B:[28-275] ---VTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIRE-IITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAA-VDSGL-VDMIDLELFTGDDEVKATVGYAHQH----NVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQ-E-R-YADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK--KASAPGQISVADLRTVLTILHQ--
35 PsiBlast_CBE 86.5242% -91 - C5 - - 3M7W AROD_SALTY D:[7-254] ---VTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIRE-IITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAA-VDSGL-VDMIDLELFTGDDEVKATVGYAHQH----NVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQ-E-R-YADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK--KASAPGQISVADLRTVLTILHQ--
9 PsiBlast_PDB 86.5142% -87 - C5 - - 3LB0 AROD_SALTY A:[28-275] ---VTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIRE-IITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAA-VDSGL-VDMIDLELFTGDDEVKATVGYAHQH----NVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQ-E-R-YADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK--KASAPGQISVADLRTVLTILHQ--
37 PsiBlast_CBE 86.4742% -93 - C5 - - 3M7W AROD_SALTY B:[7-254] ---VTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIRE-IITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAA-VDSGL-VDMIDLELFTGDDEVKATVGYAHQH----NVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQ-E-R-YADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK--KASAPGQISVADLRTVLTILHQ--
27 PsiBlast_CBE 86.3442% -92 - C5 - - 4GUJ AROD_SALTY B:[7-254] ---VTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIRE-IITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAA-VDSGL-VDMIDLELFTGDDEVKATVGYAHQH----NVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQ-E-R-YADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK--KASAPGQISVADLRTVLTILHQ--
8 PsiBlast_PDB 86.2542%-100 - C5 - - 3L2I - AROD_SALTY A:[28-275] ---VTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIRE-IITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAA-VDSGL-VDMIDLELFTGDDEVKATVGYAHQH----NVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQ-E-R-YADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK-----APGQISVADLRTVLTILHQ--
4 PsiBlast_PDB 86.1642% -91 - C5 - - 3OEX - AROD_SALTY A:[7-254] ---VTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIRE-IITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAA-VDSGL-VDMIDLELFTGDDEVKATVGYAHQH----NVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQ-E-R-YADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK--KASAPGQISVADLRTVLTILHQ--
51 PsiBlast_CBE 86.1540%-103 - C5 - - 4CNP AROD_SALTI B:[4-250] ---VTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRD-AMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAA-IDSGL-VDMIDLELFTGDADVKATVDYAHAH----NVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQ-Q-H-YADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK--QASAPGQIAVNDLRSVLMILH---
16 PsiBlast_PDB 86.1541% -93 - C5 - - 3NNT AROD_SALTY A:[28-275] ---VTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIRE-IITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAA-VDSGL-VDMIDLELFTGDDEVKATVGYAHQH----NVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPMIAVMPQTKADVLTLLTATVEMQ-E-R-YADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK--KASAPGQISVADLRTVLTILHQ--
44 PsiBlast_CBE 86.1341% -90 - C5 - - 4IUO AROD_SALTY B:[28-275] ---VTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIRE-IITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAA-VDSGL-VDMIDLELFTGDDEVKATVGYAHQH----NVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPMIAVMPQTKADVLTLLTATVEMQ-E-R-YADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK--KASAPGQISVADLRTVLTILHQ--
7 PsiBlast_PDB 86.0842% -92 - C5 - - 4GUJ AROD_SALTY A:[7-254] ---VTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIRE-IITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAA-VDSGL-VDMIDLELFTGDDEVKATVGYAHQH----NVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQ-E-R-YADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK--KASAPGQISVADLRTVLTILHQ--
33 PsiBlast_CBE 86.0542% -90 - C5 - - 3M7W AROD_SALTY F:[7-254] ---VTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIRE-IITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAA-VDSGL-VDMIDLELFTGDDEVKATVGYAHQH----NVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQ-E-R-YADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK--KASAPGQISVADLRTVLTILHQ--
15 PsiBlast_PDB 86.0341% -90 - C5 - - 3O1N - AROD_SALTY A:[28-275] ---VTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIRE-IITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAA-VDSGL-VDMIDLELFTGDDEVKATVGYAHQH----NVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQ-E-R-YADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK--KASAPGAISVADLRTVLTILHQ--
29 PsiBlast_CBE 85.9942% -94 - C5 - - 4GFS AROD_SALTY B:[7-254] ---VTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIRE-IITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAA-VDSGL-VDMIDLELFTGDDEVKATVGYAHQH----NVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQ-E-R-YADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK-----APGQISVADLRTVLTILHQ--
23 PsiBlast_CBE 85.7642% -51 - C5 - - 4H3D AROD_PEPD6 B:[8-257] ---VQVKNITIGEGRPKICVPIIGKNKKDIIKEAKELKDACLDIIEWRVDFFENVENIKEVKEVLYELRS-YIHDIPLLFTFRSVVEGGEKLISRDYYTTLNKEI-SNTGL-VDLIDVELF----MGDEVIDEVVNFAHKKEVKVIISNHDFNKTPKKEEIVSRLCRMQELGADLPKIAVMPQNEKDVLVLLEAT-NEMFK-I-YADRPIITMSMSGMGVISRLCGEIFGSALTFG--AAKSVSAPGQISFKELNSVLNLLHKSI
14 PsiBlast_PDB 85.7641% -92 - C5 - - 4GUH AROD_SALTY A:[28-275] ---VTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIRE-IITDKPLLFTFRSAKAGGEQALTTGQYIDLNRAA-VDSGL-VDMIDLELFTGDDEVKATVGYAHQH----NVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQ-E-R-YADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK--KASAPGQISVADLRTVLTILHQ--
28 PsiBlast_CBE 85.6542% -92 - C5 - - 4GUI AROD_SALTY B:[7-254] ---VTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIRE-IITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAA-VDSGL-VDMIDLELFTGDDEVKATVGYAHQH----NVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQ-E-R-YADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK--KASAPGQISVADLRTVLTILHQ--
40 PsiBlast_CBE 85.6441% -90 - C5 - - 4GUH AROD_SALTY B:[28-275] ---VTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIRE-IITDKPLLFTFRSAKAGGEQALTTGQYIDLNRAA-VDSGL-VDMIDLELFTGDDEVKATVGYAHQH----NVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQ-E-R-YADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK--KASAPGQISVADLRTVLTILHQ--
17 PsiBlast_PDB 85.5641% -93 - C5 - - 4IUO AROD_SALTY A:[28-275] ---VTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIRE-IITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAA-VDSGL-VDMIDLELFTGDDEVKATVGYAHQH----NVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPMIAVMPQTKADVLTLLTATVEMQ-E-R-YADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK--KASAPGQISVADLRTVLTILHQ--
13 PsiBlast_PDB 85.4841%-100 - C5 - - 4GUG AROD_SALTY A:[28-275] ---VTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIRE-IITDKPLLFTFRSAKAGGEQALTTGQYIDLNRAA-VDSGL-VDMIDLELFTGDDEVKATVGYAHQH----NVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQ-E-R-YADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK------PGQISVADLRTVLTILHQ--
52 PsiBlast_CBE 85.4640% -97 - C5 - - 4CNP AROD_SALTI A:[4-250] ---VTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRD-AMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAA-IDSGL-VDMIDLELFTGDADVKATVDYAHAH----NVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQ-Q-H-YADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK--QASAPGQIAVNDLRSVLMILH---
50 PsiBlast_CBE 85.2140% -97 - C5 - - 4UIO AROD_SALTI A:[4-250] ---VTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRD-AMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAA-IDSGL-VDMIDLELFTGDADVKATVDYAHAH----NVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQ-Q-H-YADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK--QASAPGQIAVNDLRSVLMILH---
25 PsiBlast_CBE 85.2142% -48 - C5 - - 3JS3 AROD_PEPD6 C:[8-256] ---VQVKNITIGEGRPKICVPIIGKNKKDIIKEAKELKDACLDIIEWRVDFFENVENIKEVKEVLYELRS-YIHDIPLLFTFRSVVEGGEKLISRDYYTTLNKEI-SNTGL-VDLIDVELF----MGDEVIDEVVNFAHKKEVKVIISNHDFNKTPKKEEIVSRLCRMQELGADLPKIAVMPQNEKDVLVLLEAT-NEMFK-I-YADRPIITMSMSGMGVISRLCGEIFGSALTFG--AAKSVSAPGQISFKELNSVLNLLHKS-
59 PsiBlast_CBE 85.2040% -97 - C5 - - 4CLM AROD_SALTI B:[4-250] ---VTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRD-AMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAA-IDSGL-VDMIDLELFTGDADVKATVDYAHAH----NVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQ-Q-H-YADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK--QASAPGQIAVNDLRSVLMILH---
21 PsiBlast_CBE 85.0242% -50 - C5 - - 4H3D AROD_PEPD6 D:[8-257] ---VQVKNITIGEGRPKICVPIIGKNKKDIIKEAKELKDACLDIIEWRVDFFENVENIKEVKEVLYELRS-YIHDIPLLFTFRSVVEGGEKLISRDYYTTLNKEI-SNTGL-VDLIDVELF----MGDEVIDEVVNFAHKKEVKVIISNHDFNKTPKKEEIVSRLCRMQELGADLPKIAVMPQNEKDVLVLLEAT-NEMFK-I-YADRPIITMSMSGMGVISRLCGEIFGSALTFG--AAK--SAPGQISFKELNSVLNLLHKSI
1 PsiBlast_PDB 84.8342% -47 - C5 - - 3JS3 AROD_PEPD6 A:[8-256] ---VQVKNITIGEGRPKICVPIIGKNKKDIIKEAKELKDACLDIIEWRVDFFENVENIKEVKEVLYELRS-YIHDIPLLFTFRSVVEGGEKLISRDYYTTLNKEI-SNTGL-VDLIDVELF----MGDEVIDEVVNFAHKKEVKVIISNHDFNKTPKKEEIVSRLCRMQELGADLPKIAVMPQNEKDVLVLLEAT-NEMFK-I-YADRPIITMSMSGMGVISRLCGEIFGSALTFG--AAKSVSAPGQISFKELNSVLNLLHKS-
48 PsiBlast_CBE 84.7740% -98 - C5 - - 1L9W AROD_SALTI C:[4-250] ---VTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRD-AMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAA-IDSGL-VDMIDLELFTGDADVKATVDYAHAH----NVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQ-Q-H-YADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK--QASAPGQIAVNDLRSVLMILH---
49 PsiBlast_CBE 84.7640% -95 - C5 - - 1L9W AROD_SALTI B:[4-250] ---VTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRD-AMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAA-IDSGL-VDMIDLELFTGDADVKATVDYAHAH----NVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQ-Q-H-YADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK--QASAPGQIAVNDLRSVLMILH---
10 PsiBlast_PDB 84.7142% -83 - C5 - - 3S42 AROD_SALTY A:[28-275] ---VTVRDLVVGEGAPKIIVSLMGKTI-DVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIRE-IITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAA-VDSGL-VDMIDLELFTGDDEVKATVGYAHQH----NVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQ-E-R-YADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK--KASAPGQISVADLRTVLTILHQ--
57 PsiBlast_CBE 84.5140%-104 - C5 - - 4CNN AROD_SALTI B:[4-250] ---VTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRD-AMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAA-IDSGL-VDMIDLELFTGDADVKATVDYAHAH----NVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQ-Q-H-YADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK------PGQIAVNDLRSVLMILH---
24 PsiBlast_CBE 84.5142% -50 - C5 - - 3JS3 AROD_PEPD6 D:[8-256] ---VQVKNITIGEGRPKICVPIIGKNKKDIIKEAKELKDACLDIIEWRVDFFENVENIKEVKEVLYELRS-YIHDIPLLFTFRSVVEGGEKLISRDYYTTLNKEI-SNTGL-VDLIDVELF----MGDEVIDEVVNFAHKKEVKVIISNHDFNKTPKKEEIVSRLCRMQELGADLPKIAVMPQNEKDVLVLLEAT-NEMFK-I-YADRPIITMSMSGMGVISRLCGEIFGSALTFG--AAKSVSAPGQISFKELNSVLNLLHKS-
22 PsiBlast_CBE 84.4842% -49 - C5 - - 4H3D AROD_PEPD6 C:[8-257] ---VQVKNITIGEGRPKICVPIIGKNKKDIIKEAKELKDACLDIIEWRVDFFENVENIKEVKEVLYELRS-YIHDIPLLFTFRSVVEGGEKLISRDYYTTLNKEI-SNTGL-VDLIDVELF----MGDEVIDEVVNFAHKKEVKVIISNHDFNKTPKKEEIVSRLCRMQELGADLPKIAVMPQNEKDVLVLLEAT-NEMFK-I-YADRPIITMSMSGMGVISRLCGEIFGSALTFG--AAK---APGQISFKELNSVLNLLHKSI
18 PsiBlast_PDB 84.2640% -96 - C5 - - 1QFE AROD_SALTI A:[4-250] ---VTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRD-AMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAA-IDSGL-VDMIDLELFTGDADVKATVDYAHAH----NVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQ-Q-H-YADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK--QASAPGQIAVNDLRSVLMILH---
53 PsiBlast_CBE 84.1040%-103 - C5 - - 4CNO AROD_SALTI D:[4-250] ---VTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRD-AMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAA-IDSGL-VDMIDLELFTGDADVKATVDYAHAH----NVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQ-Q-H-YADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK------PGQIAVNDLRSVLMILH---
46 PsiBlast_CBE 83.9940% -96 - C5 - - 1QFE AROD_SALTI B:[4-250] ---VTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRD-AMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAA-IDSGL-VDMIDLELFTGDADVKATVDYAHAH----NVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQ-Q-H-YADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK--QASAPGQIAVNDLRSVLMILH---
41 PsiBlast_CBE 83.8941% -98 - C5 - - 4GUG AROD_SALTY B:[28-275] ---VTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIRE-IITDKPLLFTFRSA----EQALTTGQYIDLNRAA-VDSGL-VDMIDLELFTGDDEVKATVGYAHQH----NVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQ-E-R-YADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK--KASAPGQISVADLRTVLTILHQ--
19 PsiBlast_PDB 83.7040% -90 - C5 - - 1L9W AROD_SALTI A:[4-250] ---VTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRD-AMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAA-IDSGL-VDMIDLELFTGDADVKATVDYAHAH----NVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQ-Q-H-YADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK--QASAPGQIAVNDLRSVLMILH---
47 PsiBlast_CBE 83.6440% -96 - C5 - - 1L9W AROD_SALTI D:[4-250] ---VTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRD-AMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAA-IDSGL-VDMIDLELFTGDADVKATVDYAHAH----NVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQ-Q-H-YADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK--QASAPGQIAVNDLRSVLMILH---
26 PsiBlast_CBE 83.5442% -48 - C5 - - 3JS3 AROD_PEPD6 B:[8-256] ---VQVKNITIGEGRPKICVPIIGKNKKDIIKEAKELKDACLDIIEWRVDFFENVENIKEVKEVLYELRS-YIHDIPLLFTFRSVVEGGEKLISRDYYTTLNKEI-SNTGL-VDLIDVELF----MGDEVIDEVVNFAHKKEVKVIISNHDFNKTPKKEEIVSRLCRMQELGADLPKIAVMPQNEKDVLVLLEAT-NEMFK-I-YADRPIITMSMSGMGVISRLCGEIFGSALTFG--AAKSVSAPGQISFKELNSVLNLLHKS-
54 PsiBlast_CBE 83.4640% -96 - C5 - - 4CNO AROD_SALTI C:[4-250] ---VTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRD-AMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAA-IDSGL-VDMIDLELFTGDADVKATVDYAHAH----NVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQ-Q-H-YADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK------PGQIAVNDLRSVLMILH---
2 PsiBlast_PDB 83.4342% -47 - C5 - - 4H3D AROD_PEPD6 A:[8-257] ---VQVKNITIGEGRPKICVPIIGKNKKDIIKEAKELKDACLDIIEWRVDFFENVENIKEVKEVLYELRS-YIHDIPLLFTFRSVVEGGEKLISRDYYTTLNKEI-SNTGL-VDLIDVELF----MGDEVIDEVVNFAHKKEVKVIISNHDFNKTPKKEEIVSRLCRMQELGADLPKIAVMPQNEKDVLVLLEAT-NEMFK-I-YADRPIITMSMSGMGVISRLCGEIFGSALTFG--AAK---APGQISFKELNSVLNLLHKSI
55 PsiBlast_CBE 83.3840% -98 - C5 - - 4CNO AROD_SALTI B:[4-250] ---VTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRD-AMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAA-IDSGL-VDMIDLELFTGDADVKATVDYAHAH----NVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQ-Q-H-YADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK------PGQIAVNDLRSVLMILH---
56 PsiBlast_CBE 83.2840%-100 - C5 - - 4CNO AROD_SALTI A:[4-250] ---VTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRD-AMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAA-IDSGL-VDMIDLELFTGDADVKATVDYAHAH----NVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQ-Q-H-YADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK------PGQIAVNDLRSVLMILH---
68 HHSearch 81.7842% -44 - C5 - - 4H3D AROD_PEPD6 B:[7-256] --KVQVKNITIGEGRPKICVPIIGKNKKDIIKEAKELKDACLDIIEWRVDFFENVENIKEVKEVLYELRSYIHD-IPLLFTFRSVVEGGEKLISRDYYTTLNKEI-SN-TGLVDLIDVELFMGDEVIDEVVNFAHKK----EVKVIISNHDFNKTPKKEEIVSRLCRMQELGADLPKIAVMPQNEKDVLVLLEAT-NEM-FKI-YADRPIITMSMSGMGVISRLCGEIFGSALTFGAAKS--VSAPGQISFKELNSVLNLLHKS-
67 HHSearch 78.2641% -45 * C5 * - 1QFE AROD_SALTI B:[3-251] --TVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPD-IPLLFTFRSAKEGGEQTITTQHYLTLNRAA-ID-SGLVDMIDLELFTGDADVKATVDYAHAH----NVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTAT-LEM-QQH-YADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQ--ASAPGQIAVNDLRSVLMILHN--
66 HHSearch 78.2241% -53 - C5 - - 4CNN AROD_SALTI B:[3-251] --TVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPD-IPLLFTFRSAKEGGEQTITTQHYLTLNRAA-ID-SGLVDMIDLELFTGDADVKATVDYAHAH----NVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTAT-LEM-QQH-YADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK------PGQIAVNDLRSVLMILHN--
87 Fugue 77.9140% -10 - C5 - - 1QFE AROD_SALTI A:[1-252] MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRD-AMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAA-IDSGL-VDMIDLELFTGDADVKATVDYAHAH----NVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTAT-LEM-Q-QHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAV--KQASAPGQIAVNDLRSVLMILHNA-
79 HHSearch 70.3632% -98 - C5 - - 2O7Q DHQSD_ARATH A:[2-250] ------------KNPSLICAPVMADSIDKMVIETSKAHELGADLVEIRLDWLKDFNPL----EDLKTIIK-KSP-LPTLFTYRPKWEGGQYEGDENERRDVLRLA-ME-LG-ADYIDVELQVASEFIKSID-GKKPG----KFKVIVSSHNYQNTPSVEDLDGLVARIQQTGADIVKIATTAVDIADVARMFHIT-SK-------AQVPTIGLVMGERGLMSRILCSKFGGYLTFGTLDSSKVSAPGQPTIKDLLDLYNFR----
78 HHSearch 70.0632%-101 - C5 - - 2O7S DHQSD_ARATH A:[2-251] ------------KNPSLICAPVMADSIDKMVIETSKAHELGADLVEIRLDWLKDFNPL----EDLKTIIK-KSP-LPTLFTYRPKWEGGQYEGDENERRDVLRLA-ME-LG-ADYIDVELQVASEFIKSID-GKKPG----KFKVIVSSHNYQNTPSVEDLDGLVARIQQTGADIVKIATTAVDIADVARMFHIT-SK-------AQVPTIGLVMGERGLMSRILCSKFGGYLTFGTLDSSKVSAPGQPTIKDLLDLYNFR----
61 PsiBlast_CBE 69.3333% -90 - C5 - - 2GPT DHQSD_ARATH A:[7-246] -----------------ICAPVMADSIDKMVIETSKAHELGADLVEIRLDWLKD---FNPLEDLKTIIKK---SPLPTLFTYRPKWEGGQYEGDENERRDVLRLA-MELG--ADYIDVEL-QVASEFIKSIDGKKPG----KFKVIVSSHNYQNTPSVEDLDGLVARIQQTGADIVKIATTAVDIADVARMFHIT-SKA-Q------VPTIGLVMGERGLMSRILCSKFGGYLTFGTLDSSKVSAPGQPTIKDL-----------
63 PsiBlast_CBE 68.1633% -89 - C5 - - 2O7Q DHQSD_ARATH A:[7-243] -----------------ICAPVMADSIDKMVIETSKAHELGADLVEIRLDWLKD---FNPLEDLKTIIKK---SPLPTLFTYRPKWEGGQYEGDENERRDVLRLA-MELG--ADYIDVEL-QVASEFIKSIDGKKPG----KFKVIVSSHNYQNTPSVEDLDGLVARIQQTGADIVKIATTAVDIADVARMFHIT-SKA-Q------VPTIGLVMGERGLMSRILCSKFGGYLTFGTLDSSKVSAPGQPTIKDL-----------
62 PsiBlast_CBE 67.5233% -93 - C5 - - 2O7S DHQSD_ARATH A:[7-244] -----------------ICAPVMADSIDKMVIETSKAHELGADLVEIRLDWLKD---FNPLEDLKTIIKK---SPLPTLFTYRPKWEGGQYEGDENERRDVLRLA-MELG--ADYIDVEL-QVASEFIKSIDGKKPG----KFKVIVSSHNYQNTPSVEDLDGLVARIQQTGADIVKIATTAVDIADVARMFHIT-SKA-Q------VPTIGLVMGERGLMSRILCSKFGGYLTFGTLDSSKVSAPGQPTIKDL-----------
72 HHSearch 64.0531% -72 - C5 - - 2OCZ AROD_STRP1 A:[3-226] --------------AMRIVAPVMPRHFDEAQA-IDISKYEDVNLIEWRADFLPKDEI---VAVAPAIFEK-FAG-KEIIFTLRTVQEGGNITLSSQEYVDIIKEINAI-YN-PDYIDFEYFTHKSVFQEM-----LD----FPNLILSYHNFEETPE--NLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNY