@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Q3XZC7: (2018-01-13 )
MGRRLGGKRMEQAYLDLGRKLLEEGHRKEDRTGTGTLSLFGYQMRFDLQKGFPLLTTKRVPFGLIKSELLWFLKGDTNIRYLLQNKNHIWDEWAFERYIKSPDYNGPDMTDFGHRCLTDPEFNEEYKKQSKLFCEKILTDDSFAETYGDLGHIYGYQWRHWETKDGGFIDQIKQVIEAIKKTPDSRRLIVSAWNPEDVPSMALPPCHTMFQFYVQEGRLSCQLYQRSGDVFLGVPFNIASYALLTHLIAHETGLAVGEFVHTLGDAHLYINHIEQMKEQLSREIRAFPTLVLNQEKQSVFDFEMEDIQLEGYDPHPAIKAPIAV

Atome Classification :

(97 SA) .........10........20........30........40........50.........60........70........80........90........100.......110.......120.......130.......140.......150.......160..----------------------------------.--------....170.......180.......190.......200.......210...--....220.......230.......240.......250.......260.......270.......280.......290....-----------...300.......310.......320..
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) MGRRLGGKRMEQAYLDLGRKLLEEGHRKEDRTGTGTLSLFGYQMRFDLQK-GFPLLTTKRVPFGLIKSELLWFLKGDTNIRYLLQNKNHIWDEWAFERYIKSPDYNGPDMTDFGHRCLTDPEFNEEYKKQSKLFCEKILTDDSFAETYGDLGHIYGYQWRHWETK----------------------------------D--------GGFIDQIKQVIEAIKKTPDSRRLIVSAWNPEDVPSMALPPCHTMFQFYVQ--EGRLSCQLYQRSGDVFLGVPFNIASYALLTHLIAHETGLAVGEFVHTLGDAHLYINHIEQMKEQLSREIRAFPTLVLNQEK-----------QSVFDFEMEDIQLEGYDPHPAIKAPIAV
108 HHSearch 96.6883%-134 - C5 - - 3UWL TYSY_ENTFA B:[1-315] ---------MEEAYLALGKKILEEGHFKEDRTGTGTYSLFGYQMRFDLAK-GFPLLTTKRVPFGLIKSELLWFLKGDTNIRYLLERNNHIWDEWAFERYVKSADYQGPDMTDFGHRVLQDPAFAEQYKEEHQKFCDAILNDAEFAEKYGELGNIYGAQWRHWETK----------------------------------D--------GSFIDQLANVIEMIKTNPDSRRLIVSAWNPEDVPSMALPPCHTMFQFYVN--EGKLSCQLYQRSADVFLGVPFNIASYALLTHLIAHETGLEVGEFVHTLGDAHLYQNHVEQMQEQLSREVRSFPTLVLNPDK-----------ASVFDFDMEDIKVEGYDPHPTIKAPIAV
28 PsiBlast_CBE 96.6582%-136 - C5 - - 3UWL TYSY_ENTFA D:[1-315] ---------MEEAYLALGKKILEEGHFKEDRTGTGTYSLFGYQMRFDLAK-GFPLLTTKRVPFGLIKSELLWFLKGDTNIRYLLERNNHIWDEWAFERYVKSADYQGPDMTDFGHRVLQDPAFAEQYKEEHQKFCDAILNDAEFAEKYGELGNIYGAQWRHWETK----------------------------------D--------GSFIDQLANVIEMIKTNPDSRRLIVSAWNPEDVPSMALPPCHTMFQFYVN--EGKLSCQLYQRSADVFLGVPFNIASYALLTHLIAHETGLEVGEFVHTLGDAHLYQNHVEQMQEQLSREVRSFPTLVLNPDK-----------ASVFDFDMEDIKVEGYDPHPTIKAPIAV
29 PsiBlast_CBE 96.3182%-134 - C5 - - 3UWL TYSY_ENTFA B:[1-315] ---------MEEAYLALGKKILEEGHFKEDRTGTGTYSLFGYQMRFDLAK-GFPLLTTKRVPFGLIKSELLWFLKGDTNIRYLLERNNHIWDEWAFERYVKSADYQGPDMTDFGHRVLQDPAFAEQYKEEHQKFCDAILNDAEFAEKYGELGNIYGAQWRHWETK----------------------------------D--------GSFIDQLANVIEMIKTNPDSRRLIVSAWNPEDVPSMALPPCHTMFQFYVN--EGKLSCQLYQRSADVFLGVPFNIASYALLTHLIAHETGLEVGEFVHTLGDAHLYQNHVEQMQEQLSREVRSFPTLVLNPDK-----------ASVFDFDMEDIKVEGYDPHPTIKAPIAV
22 PsiBlast_CBE 95.6882%-135 - C5 - - 5J7W TYSY_ENTFA C:[1-315] ---------MEEAYLALGKKILEEGHFKEDRTGTGTYSLFGYQMRFDLAK-GFPLLTTKRVPFGLIKSELLWFLKGDTNIRYLLERNNHIWDEWAFERYVKSADYQGPDMTDFGHRVLQDPAFAEQYKEEHQKFCDAILNDAEFAEKYGELGNIYGAQWRHWETK----------------------------------D--------GSFIDQLANVIEMIKTNPDSRRLIVSAWNPEDVPSMALPPCHTMFQFYVN--EGKLSCQLYQRSADVFLGVPFNIASYALLTHLIAHETGLEVGEFVHTLGDAHLYQNHVEQMQEQLSREVRSFPTLVLNPDK-----------ASVFDFDMEDIKVEGYDPHPTIKAPIAV
26 PsiBlast_CBE 95.5482%-132 - C5 - - 4O7U TYSY_ENTFA B:[1-315] ---------MEEAYLALGKKILEEGHFKEDRTGTGTYSLFGYQMRFDLAK-GFPLLTTKRVPFGLIKSELLWFLKGDTNIRYLLERNNHIWDEWAFERYVKSADYQGPDMTDFGHRVLQDPAFAEQYKEEHQKFCDAILNDAEFAEKYGELGNIYGAQWRHWETK----------------------------------D--------GSFIDQLANVIEMIKTNPDSRRLIVSAWNPEDVPSMALPPCHTMFQFYVN--EGKLSCQLYQRSADVFLGVPFNIASYALLTHLIAHETGLEVGEFVHTLGDAHLYQNHVEQMQEQLSREVRSFPTLVLNPDK-----------ASVFDFDMEDIKVEGYDPHPTIKAPIAV
21 PsiBlast_CBE 95.4582%-127 - C5 - - 5J7W TYSY_ENTFA D:[1-315] ---------MEEAYLALGKKILEEGHFKEDRTGTGTYSLFGYQMRFDLAK-GFPLLTTKRVPFGLIKSELLWFLKGDTNIRYLLERNNHIWDEWAFERYVKSADYQGPDMTDFGHRVLQDPAFAEQYKEEHQKFCDAILNDAEFAEKYGELGNIYGAQWRHWETK----------------------------------D--------GSFIDQLANVIEMIKTNPDSRRLIVSAWNPEDVPSMALPPCHTMFQFYVN--EGKLSCQLYQRSADVFLGVPFNIASYALLTHLIAHETGLEVGEFVHTLGDAHLYQNHVEQMQEQLSREVRSFPTLVLNPDK-----------ASVFDFDMEDIKVEGYDPHPTIKAPIAV
24 PsiBlast_CBE 95.3182%-133 - C5 - - 4O7U TYSY_ENTFA D:[1-315] ---------MEEAYLALGKKILEEGHFKEDRTGTGTYSLFGYQMRFDLAK-GFPLLTTKRVPFGLIKSELLWFLKGDTNIRYLLERNNHIWDEWAFERYVKSADYQGPDMTDFGHRVLQDPAFAEQYKEEHQKFCDAILNDAEFAEKYGELGNIYGAQWRHWETK----------------------------------D--------GSFIDQLANVIEMIKTNPDSRRLIVSAWNPEDVPSMALPPCHTMFQFYVN--EGKLSCQLYQRSADVFLGVPFNIASYALLTHLIAHETGLEVGEFVHTLGDAHLYQNHVEQMQEQLSREVRSFPTLVLNPDK-----------ASVFDFDMEDIKVEGYDPHPTIKAPIAV
63 PsiBlast_CBE 93.2469%-133 - C5 - - 1BP6 TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDITHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRTLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
42 PsiBlast_CBE 92.4969%-132 - C5 - - 1TSX TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRELIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
53 PsiBlast_CBE 92.3569%-131 - C5 - - 1JMH TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFIIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
44 PsiBlast_CBE 92.3269%-131 - C5 - - 1BO7 TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRTLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
14 PsiBlast_PDB 92.2469%-138 - C5 - - 3BYX TYSY_LACCA A:[2-315] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQ--PEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVA-
35 PsiBlast_CBE 92.1169%-135 - C5 - - 1NJD TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFDIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
18 PsiBlast_PDB 92.0069%-138 - C5 - - 3IJZ TYSY_LACCA A:[2-312] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKA----
55 PsiBlast_CBE 91.8469%-136 - C5 - - 1NJB TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFCIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
43 PsiBlast_CBE 91.7769%-130 - C5 - - 1BO8 TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSTRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
31 PsiBlast_CBE 91.4069%-131 - C5 - - 1TSY TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRKLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
46 PsiBlast_CBE 91.2869%-133 - C5 - - 1TSV TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRALIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
54 PsiBlast_CBE 91.2569%-133 - C5 - - 1TVV TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFCIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
7 PsiBlast_PDB 91.2569%-129 - C5 - - 1NJE TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
8 PsiBlast_PDB 91.2269%-131 - C5 - - 1THY TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
32 PsiBlast_CBE 91.1769%-126 - C5 - - 2G86 TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLFVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
50 PsiBlast_CBE 90.8869%-132 - C5 - - 1BP0 TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDITHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
51 PsiBlast_CBE 90.8669%-129 - C5 - - 2G89 TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLAVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
52 PsiBlast_CBE 90.7669%-136 - C5 - - 1JMG TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFGIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
9 PsiBlast_PDB 90.7569%-131 - C5 - - 1TSL TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
62 PsiBlast_CBE 90.4769%-129 - C5 - - 1BPJ TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSTTLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
20 PsiBlast_PDB 90.3269%-136 - C5 - - 3IK1 TYSY_LACCA A:[2-311] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIK-----
11 PsiBlast_PDB 90.1769%-123 - C5 - - 2TDM TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
10 PsiBlast_PDB 90.1569%-128 - C5 - - 1TSM TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
6 PsiBlast_PDB 90.0869%-125 - C5 - - 1LCE TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
34 PsiBlast_CBE 90.0369%-128 - C5 - - 1JMI TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFSIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
60 PsiBlast_CBE 89.9769%-125 - C5 - - 1VZB TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSQLLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKAPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
49 PsiBlast_CBE 89.9469%-125 - C5 - - 2G8A TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLMVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
47 PsiBlast_CBE 89.8769%-130 - C5 - - 1TVU TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFAIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
57 PsiBlast_CBE 89.7469%-132 - C5 - - 1VZE TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSQLLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKAPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
13 PsiBlast_PDB 89.7169%-129 - C5 - - 3BNZ TYSY_LACCA A:[2-314] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHG-DMT-FGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPV--
48 PsiBlast_CBE 89.5669%-134 - C5 - - 1JMF TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFAIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
36 PsiBlast_CBE 89.4169%-131 - C5 - - 1NJC TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFDIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
37 PsiBlast_CBE 89.3669%-124 - C5 - - 2TDD TYSY_LACCA A:[2-315] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVA-
38 PsiBlast_CBE 89.3569%-123 - C5 - - 2G8D TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLWVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV
56 PsiBlast_CBE 89.3269%-129 - C5 - - 1NJA TYSY_LACCA A:[2-316] ---------LEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSK-GFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTS----------------------------------K--------GDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVN--DGKLSLQLYQRSADIFLGVPFCIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDK-----------HDIFDFDMKDIKLLNYDPYPAIKAPVAV