@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Q3Y176: (2018-01-24 )
MLEKDIERILISQEEIQVRCKELGKELTEIYQNTNPLVVGVLKGAVPFMADIVRSIDTYLELDFMDVSSYGNATVSSGEVKIVKDLDTNVEGRDLLIVEDIIDSGRTLAYLVDLFKYRKAKSVKIVTLLDKPEGRVVNIEADYVGFNVPNEFVVGYGLDYAEAYRNLPYIGVLKPSVYQSN

Atome Classification :

(98 SA) .........10........20........30..-------..------.------.-.-.40........50.....---.---.---.---60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170.......180
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) MLEKDIERILISQEEIQVRCKELGKELTEIYQN-------TN------P------L-V-VGVLKGAVPFMADIVRSI---D---T---Y---LELDFMDVSSYGNATVSSGEVKIVKDLDTNVEGRDLLIVEDIIDSGRTLAYLVDLFKYRKAKSVKIVTLLDKPEGRVVNIEADYVGFNVPNEFVVGYGLDYAEAYRNLPYIGVLKPSVYQSN
23 PsiBlast_CBE 92.5573%-164 - C2 - - 3KB8 ? B:[25-204] MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TV------P------L-A-IGVLKGAMPFMADLLKRT---D---T---Y---LEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYSN-
1 PsiBlast_PDB 91.1473%-162 - C2 - - 3H83 ? A:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TV------P------L-A-IGVLKGAMPFMADLLKRT---D---T---Y---LEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYS--
3 PsiBlast_PDB 90.6573%-163 - C2 - - 3KB8 ? A:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TV------P------L-A-IGVLKGAMPFMADLLKRT---D---T---Y---LEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYS--
127 HHSearch 90.5674%-162 - C2 - - 3KB8 ? A:[26-203] -MNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TV------P------L-A-IGVLKGAMPFMADLLKRT---D---T---Y---LEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYS--
29 PsiBlast_CBE 89.8173%-156 - C2 - - 3H83 ? B:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TV------P------L-A-IGVLKGAMPFMADLLKRT---D---T---Y---LEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYS--
6 PsiBlast_PDB 88.7656%-162 - C2 - - 1YFZ ? A:[30-204] ---EDIEEILITEEQLKAKVKELGEMITRDYEG-------KD------L------V-L-IGVLKGAIMFMSGLSRAI---D---L---P---LSIDFLAVSSYGSSTKSSGIVKIIKDHDIDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREADVKVDYCGFKIPDKFVVGYGLDYAEKYRNLPFIGVLKPELY---
26 PsiBlast_CBE 88.2673%-156 - C2 - - 3HVU ? B:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TV------P------L-A-IGVLKGAMPFMADLLKRT---D---T---Y---LEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYS--
2 PsiBlast_PDB 88.2073%-155 - C2 - - 3HVU ? A:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TV------P------L-A-IGVLKGAMPFMADLLKRT---D---T---Y---LEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYS--
30 PsiBlast_CBE 88.1456%-164 - C2 - - 1YFZ ? B:[30-204] ---EDIEEILITEEQLKAKVKELGEMITRDYEG-------KD------L------V-L-IGVLKGAIMFMSGLSRAI---D---L---P---LSIDFLAVSSYGSSTKSSGIVKIIKDHDIDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREADVKVDYCGFKIPDKFVVGYGLDYAEKYRNLPFIGVLKPELY---
25 PsiBlast_CBE 88.0973%-153 - C2 - - 3HVU ? C:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TV------P------L-A-IGVLKGAMPFMADLLKRT---D---T---Y---LEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYS--
24 PsiBlast_CBE 87.3173%-151 - C2 - - 3HVU ? D:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TV------P------L-A-IGVLKGAMPFMADLLKRT---D---T---Y---LEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYS--
128 HHSearch 87.2174%-151 - C2 - - 3HVU ? D:[26-203] -MNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TV------P------L-A-IGVLKGAMPFMADLLKRT---D---T---Y---LEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYS--
5 PsiBlast_PDB 86.9656%-166 - C2 - - 1R3U - ? A:[30-204] ---EDIEEILITEEQLKAKVKELGEMITRDYEG-------KD------L------V-L-IGVLKGAIMFMSGLSRAI---D---L---P---LSIDFLAVSSYGSSTKSSGIVKIIKDHDIDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREADVKVDYCGFKIPDKFVVGYGLDYAEKYRNLPFIGVLKPELY---
7 PsiBlast_PDB 86.7456%-168 - C2 - - 2GEB - ? A:[10-184] ---EDIEEILITEEQLKAKVKELGEMITRDYEG-------KD------L------V-L-IGVLKGAIMFMSGLSRAI---D---L---P---LSIDFLAVSSYGSSTKSSGIVKIIKDHDIDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREADVKVDYCGFKIPDKFVVGYGIDYAEKYRNLPFIGVLKPELY---
21 PsiBlast_CBE 86.7273%-151 - C2 - - 3KB8 ? D:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TV------P------L-A-IGVLKGAMPFMADLLKRT---D---T---Y---LEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYS--
130 HHSearch 86.7057%-168 - C2 - - 2GEB - ? A:[11-184] ----DIEEILITEEQLKAKVKELGEMITRDYEG-------KD------L------V-L-IGVLKGAIMFMSGLSRAI---D---L---P---LSIDFLAVSSYGSSTKSSGIVKIIKDHDIDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREADVKVDYCGFKIPDKFVVGYGIDYAEKYRNLPFIGVLKPELY---
22 PsiBlast_CBE 85.6273%-151 - C2 - - 3KB8 ? C:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TV------P------L-A-IGVLKGAMPFMADLLKRT---D---T---Y---LEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYS--
126 HHSearch 85.5054%-162 - C2 - - 4RQA ? A:[8-184] -MHNDLKEVLLTEEDIQNICKELGAQLTKDYQG-------KP------L------V-C-VGILKGSAMFMSDLIKRI---D---T---H---LSIDFMDVSSY-----STGEVQIIKDLGSSIENKDVLIIEDILETGTTLKSITELLQSRKVNSLEIVTLLDKPNRRKADIEAKYVGKKIPDEFVVGYGLDYRELYRNLPYIGTLKPEVY---
4 PsiBlast_PDB 85.0453%-165 - C2 - - 4RQB ? A:[11-186] ----DLKEVLLTEEDIQNICKELGAQLTKDYQG-------KP------L------V-C-VGILKGSAMFMSDLIKRI---D---T---H---LSIDFMDVSSYHGGTESTGEVQIIKDLGSSIENKDVLIIEDILETGTTLKSITELLQSRKVNSLEIVTLLDKPNRRKADIEAKYVGKKIPDEFVVGYGLDYRELYRNLPYIGTLKPEVYSN-
125 HHSearch 84.5454%-165 - C2 - - 4RQB ? A:[8-185] -MHNDLKEVLLTEEDIQNICKELGAQLTKDYQG-------KP------L------V-C-VGILKGSAMFMSDLIKRI---D---T---H---LSIDFMDVSSYHGGTESTGEVQIIKDLGSSIENKDVLIIEDILETGTTLKSITELLQSRKVNSLEIVTLLDKPNRRKADIEAKYVGKKIPDEFVVGYGLDYRELYRNLPYIGTLKPEVYS--
50 PsiBlast_CBE 84.1048%-174 - C2 - - 4QYI ? C:[7-173] ----EIKDTLISEEQLQEKVKELALQIERDFEG-------EE------I------V-V-IAVLKGSFVFAADLIRHI---K---N---D---VTIDFISASSYGNQTETTGKVKLLKDIDVNITGKNVIVVEDIIDSGLTLHFLKDHFFMHKPKALKFCTLLDKPERRKVDLTAEYVGFQIPDEFIVGYGIDCAEKYRNLPFIA----------
123 HHSearch 83.3646%-175 - C2 - - 4QYI ? B:[6-176] ---IEIKDTLISEEQLQEKVKELALQIERDFEG-------EE------I------V-V-IAVLKGSFVFAADLIRHI---K---N---D---VTIDFISASSYGNQTETTGKVKLLKDIDVNITGKNVIVVEDIIDSGLTLHFLKDHFFMHKPKALKFCTLLDKPERRKVDLTAEYVGFQIPDEFIVGYGIDCAEKYRNLPFIASVV-------
20 PsiBlast_PDB 82.2348%-180 - C2 - - 3O7M ? A:[7-173] ----EIKDTLISEEQLQEKVKELALQIERDFEG-------EE------I------V-V-IAVLKGSFVFAADLIRHI---K---N---D---VTIDFISASSYG-------KVKLLKDIDVNITGKNVIVVEDIIDSGLTLHFLKDHFFMHKPKALKFCTLLDKPERRKVDLTAEYVGFQIPDEFIVGYGIDCAEKYRNLPFIA----------
19 PsiBlast_PDB 81.3348%-175 - C2 - - 4QYI ? B:[7-173] ----EIKDTLISEEQLQEKVKELALQIERDFEG-------EE------I------V-V-IAVLKGSFVFAADLIRHI---K---N---D---VTIDFISASSYGNQTETTGKVKLLKDIDVNITGKNVIVVEDIIDSGLTLHFLKDHFFMHKPKALKFCTLLDKPERRKVDLTAEYVGFQIPDEFIVGYGIDCAEKYRNLPFIA----------
43 PsiBlast_CBE 80.9048%-185 - C2 - - 3O7M ? C:[7-173] ----EIKDTLISEEQLQEKVKELALQIERDFEG-------EE------I------V-V-IAVLKGSFVFAADLIRHI---K---N---D---VTIDFISASSYG-------KVKLLKDIDVNITGKNVIVVEDIIDSGLTLHFLKDHFFMHKPKALKFCTLLDKPERRKVDLTAEYVGFQIPDEFIVGYGIDCAEKYRNLPFIA----------
42 PsiBlast_CBE 79.2048%-185 - C2 - - 3O7M ? D:[7-173] ----EIKDTLISEEQLQEKVKELALQIERDFEG-------EE------I------V-V-IAVLKGSFVFAADLIRHI---K---N---D---VTIDFISASSY--------KVKLLKDIDVNITGKNVIVVEDIIDSGLTLHFLKDHFFMHKPKALKFCTLLDKPERRKVDLTAEYVGFQIPDEFIVGYGIDCAEKYRNLPFIA----------
141 HHSearch 74.0245% -29 - C2 - - 1TC1 ? B:[5-189] ---EFAEKILFTEEEIRTRIKEVAKRIADDYKGKGLRPYVNP------L------V-L-ISVLKGSFMFTADLCRAL---CDFNV---P---VRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY---
76 PsiBlast_CBE 73.3845% -35 - C2 - - 1TC2 ? B:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VN------P------L-VLISVLKGSFMFTADLCRAL---C---D---FNVPVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY---
88 PsiBlast_CBE 73.2145% -34 - C2 - - 1I14 ? B:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VN------P------L-VLISVLKGSFMFTADLCRAL---C---D---FNVPVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVETALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY---
92 PsiBlast_CBE 72.9345% -37 - C2 - - 1I0I ? B:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VN------P------L-VLISVLKGSFMFTADLCRAL---C---D---FNVPVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVQTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY---
94 PsiBlast_CBE 72.9045% -36 - C2 - - 1I13 ? B:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VN------P------L-VLISVLKGSFMFTADLCRAL---C---D---FNVPVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVATALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY---
74 PsiBlast_CBE 72.9045% -29 - C2 - - 1TC1 ? B:[8-189] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VN------P------L-VLISVLKGSFMFTADLCRAL---C---D---FNVPVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY---
82 PsiBlast_CBE 72.2545% -39 - C2 - - 1P18 ? B:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VN------P------L-VLISVLRGSFMFTADLCRAL---C---D---FNVPVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY---
93 PsiBlast_CBE 71.8445% -31 - C2 - - 1I0I ? A:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VN------P------L-VLISVLKGSFMFTADLCRAL---C---D---FNVPVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVQTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY---
95 PsiBlast_CBE 71.5445% -29 - C2 - - 1I13 ? A:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VN------P------L-VLISVLKGSFMFTADLCRAL---C---D---FNVPVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVATALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY---
89 PsiBlast_CBE 71.4545% -25 - C2 - - 1I14 ? A:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VN------P------L-VLISVLKGSFMFTADLCRAL---C---D---FNVPVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVETALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY---
85 PsiBlast_CBE 71.3945% -29 - C2 - - 1P17 ? C:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VN------P------L-VLISVLRGSFMFTADLCRAL---C---D---FNVPVRMEFICVSSYGE---SSGQVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY---
90 PsiBlast_CBE 71.2445% -30 - C2 - - 1I0L ? B:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VN------P------L-VLISVLKGSFMFTADLCRAL---C---D---FNVPVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVNTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY---
83 PsiBlast_CBE 71.2445% -26 - C2 - - 1P18 ? A:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VN------P------L-VLISVLRGSFMFTADLCRAL---C---D---FNVPVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY---
81 PsiBlast_CBE 69.8045% -26 - C2 - - 1P19 ? A:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VN------P------L-VLISVLKGSFMFTADLCRAL---C---D---FNVPVRMEFICVSSY--GLTSSGQVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY---
87 PsiBlast_CBE 69.6945% -29 - C2 - - 1P17 ? A:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VN------P------L-VLISVLRGSFMFTADLCRAL---C---D---FNVPVRMEFICVSSYG---TSSGQVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY---
77 PsiBlast_CBE 69.6745% -28 - C2 - - 1TC2 ? A:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VN------P------L-VLISVLKGSFMFTADLCRAL---C---D---FNVPVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY---
91 PsiBlast_CBE 69.4745% -24 - C2 - - 1I0L ? A:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VN------P------L-VLISVLKGSFMFTADLCRAL---C---D---FNVPVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVNTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY---
142 HHSearch 69.1744% -29 - C2 - - 1P17 ? B:[4-191] -EYEFAEKILFTEEEIRTRIKEVAKRIADDYKGKGLRPYVNP------L------V-L-ISVLRGSFMFTADLCRAL---CDFNV---P---VRMEFICVSSY------SGQVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVYA--
86 PsiBlast_CBE 68.9245% -30 - C2 - - 1P17 ? B:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VN------P------L-VLISVLRGSFMFTADLCRAL---C---D---FNVPVRMEFICVSSY------SGQVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY---
79 PsiBlast_CBE 68.9145% -18 - C2 - - 1P19 ? C:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VN------P------L-VLISVLKGSFMFTADLCRAL---C---D---FNVPVRMEFICVSSYGE----SGQVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY---
78 PsiBlast_CBE 68.8545% -41 - C2 - - 1P19 ? D:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VN------P------L-VLISVLKGSFMFTADLCRAL---C---D---FNVPVRMEFICVS----------QVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY---
138 HHSearch 68.0647% -56 - C2 - - 5KNX ? B:[5-179] --MKHTVEVMIPEAEIKARIAELGRQITERYKDSG-----SD------M------V-L-VGLLRGSFMFMADLCREV---Q---V---S---HEVDFMTASSYGSGMSTTRDVKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVEFIGFSIPDEFVVGYGIDYAQRYRHLPYIGKVIL------
84 PsiBlast_CBE 68.0145% -49 - C2 - - 1P17 ? D:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VN------P------L-VLISVLRGSFMFTADLCRAL---C---D---FNVPVRMEFICVSSY---------VRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY---
12 PsiBlast_PDB 67.6149% -60 - C2 - - 5KNT ? A:[11-175] --------VMIPEAEIKARIAELGRQITERYKD-------SG------SDM----V-L-VGLLRGSFMFMADLCREV---Q---V---S---HEVDFMTASS--------RDVKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVEFIGFSIPDEFVVGYGIDYAQRYRHLPYIG----------
75 PsiBlast_CBE 67.2445% -46 - C2 - - 1TC1 ? A:[8-187] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VN------P------L-VLISVLKGSFMFTADLCRAL---C---D---FNVPVRMEFICVSSY---------VRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPE-----
39 PsiBlast_CBE 66.6448% -60 - C2 - - 1G9T HPRT_ECOLI B:[11-175] --------VMIPEAEIKARIAELGRQITERYKD-------SG------SDM----V-L-VGLLRGSFMFMADLCREV---Q---V---S---HEVDFMTASS--------RDLKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVEFIGFSIPDEFVVGYGIDYAQRYRHLPYIG----------
14 PsiBlast_PDB 66.6449% -58 - C2 - - 5KNV ? A:[11-175] --------VMIPEAEIKARIAELGRQITERYKD-------SG------SDM----V-L-VGLLRGSFMFMADLCREV---Q---V---S---HEVDFMTASS-------TRDVKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVEFIGFSIPDEFVVGYGIDYAQRYRHLPYIG----------
121 HHSearch 66.1650% -12 - C2 - - 4RHX HPRT_MYCTU A:[18-200] -YPGDIKSVLLTAEQIQARIAELGEQIGNDYRELSATTG-QD------L------L-L-ITVLKGAVLFVTDLARAI---P---V---P---TQFEFMAVSSYG----SSGVVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVY---
11 PsiBlast_PDB 65.5349% -55 - C2 - - 5KNS ? A:[11-175] --------VMIPEAEIKARIAELGRQITERYKD-------SG------SDM----V-L-VGLLRGSFMFMADLCREV---Q---V---S---HEVDFMTASS-------TRDVKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVEFIGFSIPDEFVVGYGIDYAQRYRHLPYIG----------
56 PsiBlast_CBE 65.3249% -1 - C2 - - 4RHY HPRT_MYCTU D:[21-201] ----DIKSVLLTAEQIQARIAELGEQIGNDYR----------------ATTGQDLL-L-ITVLKGAVLFVTDLARAI---P---V---P---TQFEFMAVSSYGS----SGVVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQ--
58 PsiBlast_CBE 65.2149% -25 - C2 - - 4RHY HPRT_MYCTU B:[21-200] ----DIKSVLLTAEQIQARIAELGEQIGNDYR-----------------GQDL--L-L-ITVLKGAVLFVTDLARAI---P---V---P---TQFEFMAVSSYG------GVVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVY---
63 PsiBlast_CBE 65.1849% -12 - C2 - - 4RHX HPRT_MYCTU A:[21-200] ----DIKSVLLTAEQIQARIAELGEQIGNDYRE-------LS------ATTGQDLL-L-ITVLKGAVLFVTDLARAI---P---V---P---TQFEFMAVSSYGS----SGVVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVY---
72 PsiBlast_CBE 65.0249% -40 - C2 - - 4RHT HPRT_MYCTU B:[21-199] ----DIKSVLLTAEQIQARIAELGEQIGNDYRE----------------QDL---L-L-ITVLKGAVLFVTDLARAI---P---V---P---TQFEFMAVSSY--------VVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRV----
61 PsiBlast_CBE 64.8649% -4 - C2 - - 4RHX HPRT_MYCTU C:[21-201] ----DIKSVLLTAEQIQARIAELGEQIGNDYRE-------LS------ATTGQDLL-L-ITVLKGAVLFVTDLARAI---P---V---P---TQFEFMAVSS----------VRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVH-NVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQ--
68 PsiBlast_CBE 64.5749% 5 - C2 - - 4RHU HPRT_MYCTU B:[21-201] ----DIKSVLLTAEQIQARIAELGEQIGNDYRE-------LS------ATTGQDLL-L-ITVLKGAVLFVTDLARAI---P---V---P---TQFEFMAVSSYG-------VVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAV--NVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQ--
59 PsiBlast_CBE 64.2149% -17 - C2 - - 4RHY HPRT_MYCTU A:[21-200] ----DIKSVLLTAEQIQARIAELGEQIGNDYRE----------------GQDL--L-L-ITVLKGAVLFVTDLARAI---P---V---P---TQFEFMAVSSY--------VVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVY---
13 PsiBlast_PDB 64.1849% -54 - C2 - - 5KNU ? A:[11-175] --------VMIPEAEIKARIAELGRQITERYKD-------SG------SDM----V-L-VGLLRGSFMFMADLCREV---Q---V---S---HEVDFMTASS-------TRDVKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVEFIGFSIPDEFVVGYGIDYAQRYRHLPYIG----------
33 PsiBlast_CBE 64.0949% -53 - C2 - - 5KNV ? B:[11-175] --------VMIPEAEIKARIAELGRQITERYKD-------SG------SDM----V-L-VGLLRGSFMFMADLCREV---Q---V---S---HEVDFMTASS-------TRDVKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVEFIGFSIPDEFVVGYGIDYAQRYRHLPYIG----------
80 PsiBlast_CBE 63.9845% -34 - C2 - - 1P19 ? B:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VN------P------L-VLISVLKGSFMFTADLCRAL---C---D---FNVPVRMEFICVS------------RMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY---
32 PsiBlast_CBE 63.9449% -57 - C2 - - 5KNX ? B:[11-175] --------VMIPEAEIKARIAELGRQITERYKD-------SG------SDM----V-L-VGLLRGSFMFMADLCREV---Q---V---S---HEVDFMTASSYGSGMSTTRDVKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVEFIGFSIPDEFVVGYGIDYAQRYRHLPYIG----------
40 PsiBlast_CBE 63.5848% -57 - C2 - - 1G9S HPRT_ECOLI B:[11-175] --------VMIPEAEIKARIAELGRQITERYKD-------SG------SDM----V-L-VGLLRGSFMFMADLCREV---Q---V---S---HEVDFMTASS--------RDLKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVEFIGFSIPDEFVVGYGIDYAQRYRHLPYIG----------
67 PsiBlast_CBE 63.5349% -5 - C2 - - 4RHU HPRT_MYCTU C:[21-198] ----DIKSVLLTAEQIQARIAELGEQIGNDYRE-------LS------ATTGQDLL-L-ITVLKGAVLFVTDLARAI---P---V---P---TQFEFMAVSSYG-------VVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPR-----
36 PsiBlast_CBE 63.3549% -56 - C2 - - 5KNS ? B:[11-175] --------VMIPEAEIKARIAELGRQITERYKD-------SG------SDM----V-L-VGLLRGSFMFMADLCREV---Q---V---S---HEVDFMTAS------STTRDVKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVEFIGFSIPDEFVVGYGIDYAQRYRHLPYIG----------
70 PsiBlast_CBE 63.3149% -40 - C2 - - 4RHT HPRT_MYCTU D:[21-197] ----DIKSVLLTAEQIQARIAELGEQIGNDY------------------QDL---L-L-ITVLKGAVLFVTDLARAI---P---V---P---TQFEFMAVSSYGS----SGVVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPD---ANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDP------
10 PsiBlast_PDB 63.2849% -60 - C2 - - 5KNR ? A:[11-175] --------VMIPEAEIKARIAELGRQITERYKD-------SG------SDM----V-L-VGLLRGSFMFMADLCREV---Q---V---S---HEVDFMTASSYG-----TRDVKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVEFIGFSIPDEFVVGYGIDYAQRYRHLPYIG----------
15 PsiBlast_PDB 63.2349% -68 - C2 - - 5KNX ? A:[11-175] --------VMIPEAEIKARIAELGRQITERYKD-------SG------SDM----V-L-VGLLRGSFMFMADLCREV---Q---V---S---HEVDFMTASSYGS----TRDVKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVEFIGFSIPDEFVVGYGIDYAQRYRHLPYIG----------
64 PsiBlast_CBE 63.0249% -21 - C2 - - 4RHU HPRT_MYCTU F:[21-201] ----DIKSVLLTAEQIQARIAELGEQIGNDYR-----------------GQDL--L-L-ITVLKGAVLFVTDLARAI---P---V---P---TQFEFMAVSSY--------VVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQ--
35 PsiBlast_CBE 63.0249% -54 - C2 - - 5KNT ? B:[11-175] --------VMIPEAEIKARIAELGRQITERYKD-------SG------SDM----V-L-VGLLRGSFMFMADLCREV---Q---V---S---HEVDFMTAS------STTRDVKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVEFIGFSIPDEFVVGYGIDYAQRYRHLPYIG----------