@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Q3Y2D9: (2018-01-30 )
MKIGIIGAMEEEVKILRENLSEPLSWERAGALFISGSLGNHEVIVVRSGIGKVLASITTSLLIQQYGVNMVINTGSAGGIGEGLQVGDIVISDKVAYFDADATGFGYNPGQLPGMPLYYEASTYLRSEMVKAAKATNLNAKEGLIVTGDTFVDSPDKIKEILTNFPEALACEMEGAAVGQTARQFNIPFLIVRAMSDTADHSATQSFDEFIEDAGKRSAEMVIEFVKHLV

Atome Classification :

(81 SA) .........10.......----.20--.-...-...---.30........40........50........60........70........80........90........100.......110.......120.......130-..-.---....140........150.......160.......170.......180.......190.......200.......210.......220.......230
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) MKIGIIGAMEEEVKILRE----NLS--E-PLS-WER---AGALFISGSLGNHEVIVVRSGIGKVLASITTSLLIQQYGVNMVINTGSAGGIGEGLQVGDIVISDKVAYFDADATGFGYNPGQLPGMPLYYEASTYLRSEMVKA-AK-A---TNLNA-KEGLIVTGDTFVDSPDKIKEILTNFPEALACEMEGAAVGQTARQFNIPFLIVRAMSDTADHSATQSFDEFIEDAGKRSAEMVIEFVKHLV
42 PsiBlast_CBE 95.2845%-117 - C1 - - 1Y6Q MTNN_ECOLI B:[11-239] MKIGIIGAMEEEVTLLRD----KIE--N-RQT-ISL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEAC-IA-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKL-
32 PsiBlast_CBE 95.1345%-116 - C1 - - 4F3C ? B:[17-245] MKIGIIGAMEEEVTLLRD----KID--N-RQT-ITL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESC-IR-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMVETLVQKL-
33 PsiBlast_CBE 94.8145%-116 - C1 - - 4F2W ? B:[17-245] MKIGIIGAMEEEVTLLRD----KID--N-RQT-ITL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESC-IR-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMVETLVQKL-
97 HHSearch 94.7746%-124 - C1 - - 4F1W ? A:[17-245] MKIGIIGAMEEEVTLLRD----KID--N-RQT-ITL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESC-IR-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMVETLVQKL-
44 PsiBlast_CBE 94.6245%-116 - C1 - - 1NC1 MTNN_ECOLI B:[11-239] MKIGIIGAMEEEVTLLRD----KIE--N-RQT-ISL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEAC-IA-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKL-
50 PsiBlast_CBE 94.5045%-120 - C1 - - 1Z5O MTNN_ECOLI B:[11-239] MKIGIIGAMEEEVTLLRD----KIE--N-RQT-ISL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEAC-IA-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISNVADQQSHLSFDEFLAVAAKQSSLMVESLVQKL-
10 PsiBlast_PDB 94.2445%-124 - C1 - - 4F1W ? A:[17-245] MKIGIIGAMEEEVTLLRD----KID--N-RQT-ITL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESC-IR-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMVETLVQKL-
45 PsiBlast_CBE 94.2345%-129 - C1 - - 1JYS MTNN_ECOLI B:[11-239] MKIGIIGAMEEEVTLLRD----KIE--N-RQT-ISL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEAC-IA-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQ----SFDEFLAVAAKQSSLMVESLVQKL-
11 PsiBlast_PDB 94.0145%-114 - C1 - - 4F2P ? A:[17-245] MKIGIIGAMEEEVTLLRD----KID--N-RQT-ITL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESC-IR-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMVETLVQKL-
39 PsiBlast_CBE 93.9145%-132 - C1 - - 1Z5P MTNN_ECOLI A:[11-239] MKIGIIGAMEEEVTLLRD----KIE--N-RQT-ISL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEAC-IA-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKL-
96 HHSearch 93.4447%-110 - C1 - - 3BL6 MTNN_STAAM A:[2-230] MMIGIIGAMEEEVTILKN----KLT--Q-LSE-ISV---AHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQV-VQ-Q---QQLTA-KVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQTVEALVSQL-
2 PsiBlast_PDB 93.4447%-110 - C1 - - 3BL6 MTNN_STAAM A:[2-230] MMIGIIGAMEEEVTILKN----KLT--Q-LSE-ISV---AHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQV-VQ-Q---QQLTA-KVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQTVEALVSQL-
48 PsiBlast_CBE 93.4045%-118 - C1 - - 1Z5N MTNN_ECOLI B:[11-239] MKIGIIGAMEEQVTLLRD----KIE--N-RQT-ISL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEAC-IA-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKL-
40 PsiBlast_CBE 93.3945%-116 - C1 - - 1Y6R MTNN_ECOLI B:[11-239] MKIGIIGAMEEEVTLLRD----KIE--N-RQT-ISL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEAC-IA-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKL-
47 PsiBlast_CBE 93.3845%-116 - C1 - - 4WKC MTNN_ECOLI A:[1-229] MKIGIIGAMEEEVTLLRD----KIE--N-RQT-ISL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEAC-IA-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKL-
43 PsiBlast_CBE 93.3045%-113 - C1 - - 1NC3 MTNN_ECOLI B:[11-239] MKIGIIGAMEEEVTLLRD----KIE--N-RQT-ISL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEAC-IA-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKL-
13 PsiBlast_PDB 93.2545%-116 - C1 - - 4F3C ? A:[17-245] MKIGIIGAMEEEVTLLRD----KID--N-RQT-ITL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESC-IR-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMVETLVQKL-
49 PsiBlast_CBE 93.2345%-122 - C1 - - 1Z5N MTNN_ECOLI A:[11-239] MKIGIIGAMEEQVTLLRD----KIE--N-RQT-ISL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEAC-IA-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKL-
36 PsiBlast_CBE 93.2345%-116 - C1 - - 3O4V MTNN_ECOLI B:[3-231] MKIGIIGAMEEEVTLLRD----KIE--N-RQT-ISL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEAC-IA-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKL-
51 PsiBlast_CBE 93.2045%-118 - C1 - - 1Z5O MTNN_ECOLI A:[11-239] MKIGIIGAMEEEVTLLRD----KIE--N-RQT-ISL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEAC-IA-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISNVADQQSHLSFDEFLAVAAKQSSLMVESLVQKL-
37 PsiBlast_CBE 92.7045%-118 - C1 - - 3DF9 MTNN_ECO57 B:[11-239] MKIGIIGAMEEEVTLLRD----KIE--N-RQT-ISL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEAC-IA-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKL-
35 PsiBlast_CBE 92.5145%-115 - C1 - - 4F1W ? B:[17-245] MKIGIIGAMEEEVTLLRD----KID--N-RQT-ITL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESC-IR-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMVETLVQKL-
101 HHSearch 92.4845%-124 - C1 - - 4G41 ? B:[6-234] MKIGIIAAMEEELSLLLA----NLL--D-AQE-HQV---LSKTYYTGRFGKHELILVQSGVGKVMSAMTVAILVEHFKAQAIINTGSAGAVASHLAIGDVVVADRLVYHDVDATAFGYAYGQMAGQPLYYDCDPQFVAIFKQV-LK-H---EKTNG-QVGLIATGDSFVAGQDKIDQIKTAFSNVLAVEMEGAAIAQAAHTAGKPFIVVRAMSDTAAHDANITFDQFIIEAGKRSAQILMTFLENL-
52 PsiBlast_CBE 92.4845%-124 - C1 - - 4G41 ? B:[6-234] MKIGIIAAMEEELSLLLA----NLL--D-AQE-HQV---LSKTYYTGRFGKHELILVQSGVGKVMSAMTVAILVEHFKAQAIINTGSAGAVASHLAIGDVVVADRLVYHDVDATAFGYAYGQMAGQPLYYDCDPQFVAIFKQV-LK-H---EKTNG-QVGLIATGDSFVAGQDKIDQIKTAFSNVLAVEMEGAAIAQAAHTAGKPFIVVRAMSDTAAHDANITFDQFIIEAGKRSAQILMTFLENL-
41 PsiBlast_CBE 92.4045%-116 - C1 - - 1Y6R MTNN_ECOLI A:[11-239] MKIGIIGAMEEEVTLLRD----KIE--N-RQT-ISL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEAC-IA-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKL-
38 PsiBlast_CBE 92.3345%-119 - C1 - - 3DF9 MTNN_ECO57 A:[11-239] MKIGIIGAMEEEVTLLRD----KIE--N-RQT-ISL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEAC-IA-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKL-
46 PsiBlast_CBE 92.2545%-119 - C1 - - 4YML MTNN_ECOLI A:[1-229] MKIGIIGAMEEEVTLLRD----KIE--N-RQT-ISL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEAC-IA-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKL-
12 PsiBlast_PDB 92.0545%-115 - C1 - - 4F2W ? A:[17-245] MKIGIIGAMEEEVTLLRD----KID--N-RQT-ITL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESC-IR-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMVETLVQKL-
34 PsiBlast_CBE 92.0445%-117 - C1 - - 4F2P ? B:[17-245] MKIGIIGAMEEEVTLLRD----KID--N-RQT-ITL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESC-IR-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMVETLVQKL-
20 PsiBlast_PDB 92.0345%-118 - C1 - - 1Y6Q MTNN_ECOLI A:[11-239] MKIGIIGAMEEEVTLLRD----KIE--N-RQT-ISL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEAC-IA-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKL-
9 PsiBlast_PDB 91.8844%-120 - C1 - - 4G89 MTNN_KLEP7 A:[6-234] MKIGIIGAMEEEVTLLRD----KIE--N-RQT-ITI---GGSEIYTGQLHGVDVALLKSGIGKVAAAMGATLLLERCQPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADEKLVAAAESC-IK-A---LDLNA-VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFKVPFVVVRAISDVADQQSHLSFEEFLAVAARQSTLMVENLVQNL-
104 HHSearch 91.8246%-116 - C1 - - 3O4V MTNN_ECOLI A:[3-231] MKIGIIGAMEEEVTLLRD----KIE--N-RQT-ISL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEAC-IA-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKL-
110 HHSearch 91.6246% -85 - C1 - - 5UE1 MTNN_VIBF1 A:[4-233] MKIGIIGAMEQEVAILKD----KIE--G-LST-VTK---AGCTFYTGTLNGADVVLLQSGIGKVAAAVGTTLLIAEHNVDVVLNTGSAGGFDSSLNLGDVVISTEVRHHDADVTAFGYEMGQMAQQPAAFIADEKLITTAEQA-LT-EM--SDKHA-VRGLICTGDVFVCTPERQEFIRTHFPSVIAVEMEASAIAQTCHQFNTPFVVVRAISDVADKESPMSFDEFLPLAAQSSSEMVLNMVTLL-
19 PsiBlast_PDB 91.5345%-117 - C1 - - 1NC1 MTNN_ECOLI A:[11-239] MKIGIIGAMEEEVTLLRD----KIE--N-RQT-ISL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEAC-IA-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKL-
15 PsiBlast_PDB 91.2845%-116 - C1 - - 3O4V MTNN_ECOLI A:[3-231] MKIGIIGAMEEEVTLLRD----KIE--N-RQT-ISL---GGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEAC-IA-E---LNLNA-VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKL-