@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Q3Y301: (2018-02-02 )
MSKTIAINAGSSSLKWQLYQMPEETVVAKGIVERIGLQDSIFTIKYGDNQKFEQIMDIENHEVAVKMLLDQLIELQILSSYDEITGVGHRVVHGGETYGDSVVIDEKVMDRIAELAEFAPLHNPANLMGIKAFKKILPDILSVAVFDTSFHSTMPKQNYLYSLPVSYYEDFKVRKYGFHGTSHRYVSERAAKLLNKPIEELKIITCHLGNGVSITAVDGGKSMDTSMGFTPLAGVTMGTRSGDIDPAVLPYLMEKLEIDIDEMINVLNKKSGLLGLTGLSSDMRDLEKNYEKEHIRLAYDIFVDRIRKYIGGYVTTMNGVDAIVFTAGIGENDGHVRSEIIKGMSWFGCEIDPALNELRGEEVDISTKESKVRVLVIPTDEELMIARDVERLRG

Atome Classification :

(34 SA) .........10........20........-30........40........50........60........70..--..--....80........90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290..--..--.....300.......310.......320.......330.......340.......350......---.--360--.-.-.....370.......380.......390..-
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) MSKTIAINAGSSSLKWQLYQMPEETVVAK-GIVERIGLQDSIFTIKYGDNQKFEQIMDIENHEVAVKMLLDQLI--EL--QILSSYDEITGVGHRVVHGGETYGDSVVIDEKVMDRIAELAEFAPLHNPANLMGIKAFKKILPDILSVAVFDTSFHSTMPKQNYLYSLPVSYYEDFKVRKYGFHGTSHRYVSERAAKLLNKPIEELKIITCHLGNGVSITAVDGGKSMDTSMGFTPLAGVTMGTRSGDIDPAVLPYLMEKLEIDIDEMINVLNKKSGLLGLTGLSSDMRDLEKNY--EK--EH--IRLAYDIFVDRIRKYIGGYVTTMNGVDAIVFTAGIGENDGHVRSEIIKGMSWFGCEIDPALNEL---R--GEE--V-D-ISTKESKVRVLVIPTDEELMIARDVERLRG-
16 PsiBlast_PDB 88.9741% -77 - C8 - - 1X3N TDCD_SALTY A:[21-405] ----LVINCGSSSIKFSVLDVATCDVLMA-GIADGMNTENAFLSIN-GDKPIN---LAHSNYEDALKAIA---F--EL--EKRDLTDSVALIGHRIAHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVRQVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGLSSDLRVLEKAW--HE--GHERARLAIKTFVHRIARHIAGHAASLHRLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQPNSH--GER--I---ISANPSQVICAVIPTNEEKMIALDAIHL---
44 HHSearch 88.7242% -79 - C8 - - 4FWM TDCD_SALTY A:[17-406] FPVVLVINCGSSSIKFSVLDVATCDVLMA-GIADGMNTENAFLSING--DKP--INLAHSNYEDALKAIAFELE--KR--D---LTDSVALIGHRIAHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVRQVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGLSSDLRVLEKAWHEGH--ER--ARLAIKTFVHRIARHIAGHAASLHRLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQ---PNSHGE--R-I-ISANPSQVICAVIPTNEEKMIALDAIHLG--
13 PsiBlast_PDB 88.5641% -76 - C8 - - 4FWL TDCD_SALTY A:[21-405] ----LVINCGSSSIKFSVLDVATCDVLMA-GIADGMNTENAFLSIN-GDKPIN------SNYEDALKAIA---F--EL--EKRDLTDSVALIGHRIAHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVRQVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGLSSDLRVLEKAW--HE--GHERARLAIKTFVHRIARHIAGHAASLHRLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQPNSH--GER--I---ISANPSQVICAVIPTNEEKMIALDAIHL---
43 HHSearch 88.1442% -73 - C8 - - 4XH4 TDCD_SALTY A:[18-407] FPVVLVINCGSSSIKFSVLDVATCDVLMA-GIADGMNTENAFLSING--DKP--INLAHSNYEDALKAIAFELE--KR--D---LTDSVALIGHRIVHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVRQVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGLSSDLRVLEKAWHEGH--ER--ARLAIKTFVHRIARHIAGHAASLHRLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQ---PNSHGE--R-I-ISANPSQVICAVIPTNEEKMIALDAIHLG--
20 PsiBlast_PDB 88.0641% -77 - C8 - - 4FWK TDCD_SALTY A:[21-405] ----LVINCGSSSIKFSVLDVATCDVLMA-GIADGMNTENAFLSIN-GDKPIN---LAHSNYEDALKAIA---F--EL--EKRDLTDSVALIGHRIAHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVRQVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGLSSDLRVLEKAW--HE--GHERARLAIKTFVHRIARHIAGHAASLHRLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQPNSH--GER--I---ISANPSQVICAVIPTNEEKMIALDAIHL---
32 PsiBlast_CBE 87.7341% -78 - C8 - - 4FWP TDCD_SALTY A:[21-405] ----LVINCGSSSIKFSVLDVATCDVLMA-GIADGMNTENAFLSIN-GDKPIN---LAHSNYEDALKAIA---F--EL--EKRDLTDSVALIGHRIAHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVRQVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGLSSDLRVLEKAW--HE--GHERARLAIKTFVHRIARHIAGHAASLHRLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQPNSH--GER--I---ISANPSQVICAVIPTNEEKMIALDAIHL---
12 PsiBlast_PDB 87.6442% -72 - C8 - - 4XH4 TDCD_SALTY A:[22-406] ----LVINCGSSSIKFSVLDVATCDVLMA-GIADGMNTENAFLSIN-GDKPIN---LAHSNYEDALKAIA---F--EL--EKRDLTDSVALIGHRIVHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVRQVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGLSSDLRVLEKAW--HE--GHERARLAIKTFVHRIARHIAGHAASLHRLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQPNSH--GER--I---ISANPSQVICAVIPTNEEKMIALDAIHL---
30 PsiBlast_CBE 87.4441% -75 - C8 - - 4FWR TDCD_SALTY A:[21-405] ----LVINCGSSSIKFSVLDVATCDVLMA-GIADGMNTENAFLSIN-GDKPIN---LAHSNYEDALKAIA---F--EL--EKRDLTDSVALIGHRIAHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVRQVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGLSSDLRVLEKAW--HE--GHERARLAIKTFVHRIARHIAGHAASLHRLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQPNSH--GER--I---ISANPSQVICAVIPTNEEKMIALDAIHL---
18 PsiBlast_PDB 87.4441% -76 - C8 - - 2E1Z TDCD_SALTY A:[21-405] ----LVINCGSSSIKFSVLDVATCDVLMA-GIADGMNTENAFLSIN-GDKPIN---LAHSNYEDALKAIA---F--EL--EKRDLTDSVALIGHRIAHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVRQVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGLSSDLRVLEKAW--HE--GHERARLAIKTFVHRIARHIAGHAASLHRLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQPNSH--GER--I---ISANPSQVICAVIPTNEEKMIALDAIHL---
14 PsiBlast_PDB 87.3141% -78 - C8 - - 4FWM TDCD_SALTY A:[21-405] ----LVINCGSSSIKFSVLDVATCDVLMA-GIADGMNTENAFLSIN-GDKPIN---LAHSNYEDALKAIA---F--EL--EKRDLTDSVALIGHRIAHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVRQVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGLSSDLRVLEKAW--HE--GHERARLAIKTFVHRIARHIAGHAASLHRLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQPNSH--GER--I---ISANPSQVICAVIPTNEEKMIALDAIHL---
42 HHSearch 87.2344% -74 - C8 - - 4IJN ACKA_MYCS2 A:[22-397] MVTVLVVNSGSSSLKYAVVRPASGEFLAD-GIIEEIGSG------------------AVPDHDAALRAAFDELA--AA--GLHLEDLDLKAVGHRMVHGGKTFYKPSVVDDELIAKARELSPLAPLHNPPAIKGIEVARKLLPDLPHIAVFDTAFFHDLPAPASTYAIDRELAETWHIKRYGFHGTSHEYVSQQAAIFLDRPLESLNQIVLHLGNGASASAVAGGKAVDTSMGLTPMEGLVMGTRSGDIDPGVIMYLWRTAGMSVDDIESMLNRRSGVLGLGGA-SDFRKLRELIESGD--EH--AKLAYDVYIHRLRKYIGAYMAVLGRTDVISFTAGVGENVPPVRRDALAGLGGLGIEIDDALNSA---KS-DEP--R-L-ISTPDSRVTVLVVPTNEELAIARACVGV---
33 PsiBlast_CBE 87.1041% -76 - C8 - - 4FWO TDCD_SALTY A:[21-405] ----LVINCGSSSIKFSVLDVATCDVLMA-GIADGMNTENAFLSIN-GDKPIN---LAHSNYEDALKAIA---F--EL--EKRDLTDSVALIGHRIAHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVRQVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGLSSDLRVLEKAW--HE--GHERARLAIKTFVHRIARHIAGHAASLHRLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQPNSH--GER--I---ISANPSQVICAVIPTNEEKMIALDAIHL---
31 PsiBlast_CBE 86.9941% -75 - C8 - - 4FWQ TDCD_SALTY A:[21-405] ----LVINCGSSSIKFSVLDVATCDVLMA-GIADGMNTENAFLSIN-GDKPIN---LAHSNYEDALKAIA---F--EL--EKRDLTDSVALIGHRIAHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVRQVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGLSSDLRVLEKAW--HE--GHERARLAIKTFVHRIARHIAGHAASLHRLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQPNSH--GER--I---ISANPSQVICAVIPTNEEKMIALDAIHL---
29 PsiBlast_CBE 86.8541% -75 - C8 - - 4FWS TDCD_SALTY A:[21-405] ----LVINCGSSSIKFSVLDVATCDVLMA-GIADGMNTENAFLSIN-GDKPIN---LAHSNYEDALKAIA---F--EL--EKRDLTDSVALIGHRIAHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVRQVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGLSSDLRVLEKAW--HE--GHERARLAIKTFVHRIARHIAGHAASLHRLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQPNSH--GER--I---ISANPSQVICAVIPTNEEKMIALDAIHL---
36 PsiBlast_CBE 86.8441% -76 - C8 - - 4XH5 TDCD_SALTY A:[22-406] ----LVINCGSSSIKFSVLDVATCDVLMA-GIADGM--ENAFLSIN--DKPIN---LAHSNYEDALKAIA---F--EL--EKRDLTDSVALIGHRIGHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVRQVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGLSSDLRVLEKAW--HE--GHERARLAIKTFVHRIARHIAGHAASLHRLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQPNSH--GER--I---ISANPSQVICAVIPTNEEKMIALDAIHL---
35 PsiBlast_CBE 86.8041% -76 - C8 - - 4XH1 TDCD_SALTY A:[22-406] ----LVINCGSSSIKFSVLDVATCDVLMA-GIADGM-TENAFLSIN-GDKPIN---LAHSNYEDALKAIA---F--EL--EKRDLTDSVALIGHRIAHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVRQVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGLSSDLRVLEKAW--HE--GHERARLAIKTFVHRIARHIAGHAASLHRLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQPNSH--GER--I---ISANPSQVICAVIPTNEEKMIALDAIHL---
15 PsiBlast_PDB 86.7541% -75 - C8 - - 1X3M TDCD_SALTY A:[21-405] ----LVINCGSSSIKFSVLDVATCDVLMA-GIADGMNTENAFLSIN-GDKPIN---LAHSNYEDALKAIA---F--EL--EKRDLTDSVALIGHRIAHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVRQVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGLSSDLRVLEKAW--HE--GHERARLAIKTFVHRIARHIAGHAASLHRLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQPNSH--GER--I---ISANPSQVICAVIPTNEEKMIALDAIHL---
19 PsiBlast_PDB 86.7041% -73 - C8 - - 2E20 TDCD_SALTY A:[21-405] ----LVINCGSSSIKFSVLDVATCDVLMA-GIADGMNTENAFLSIN-GDKPIN---LAHSNYEDALKAIA---F--EL--EKRDLTDSVALIGHRIAHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVRQVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGLSSDLRVLEKAW--HE--GHERARLAIKTFVHRIARHIAGHAASLHRLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQPNSH--GER--I---ISANPSQVICAVIPTNEEKMIALDAIHL---
34 PsiBlast_CBE 86.4541% -73 - C8 - - 4FWN TDCD_SALTY A:[21-405] ----LVINCGSSSIKFSVLDVATCDVLMA-GIADGMNTENAFLSIN-GDKPIN---LAHSNYEDALKAIA---F--EL--EKRDLTDSVALIGHRIAHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVRQVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGLSSDLRVLEKAW--HE--GHERARLAIKTFVHRIARHIAGHAASLHRLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQPNSH--GER--I---ISANPSQVICAVIPTNEEKMIALDAIHL---
8 PsiBlast_PDB 85.5042% -71 - C8 - - 4IJN ACKA_MYCS2 A:[22-392] MVTVLVVNSGSSSLKYAVVRPASGEFLAD-GIIEEIGSGA------------------VPDHDAALRAAFDELA--AA--GLHLEDLDLKAVGHRMVHGGKTFYKPSVVDDELIAKARELSPLAPLHNPPAIKGIEVARKLLPDLPHIAVFDTAFFHDLPAPASTYAIDRELAETWHIKRYGFHGTSHEYVSQQAAIFLDRPLESLNQIVLHLGNGASASAVAGGKAVDTSMGLTPMEGLVMGTRSGDIDPGVIMYLWRTAGMSVDDIESMLNRRSGVLGLGG-ASDFRKLRELI--ESGDEH--AKLAYDVYIHRLRKYIGAYMAVLGRTDVISFTAGVGENVPPVRRDALAGLGGLGIEIDDALNSA---K--SDE--P-RLISTPDSRVTVLVVPTNEELAIAR--------
28 PsiBlast_CBE 85.3242% -71 - C8 - - 4IJN ACKA_MYCS2 B:[23-392] -VTVLVVNSGSSSLKYAVVRPASGEFLAD-GIIEEIGSGA------------------VPDHDAALRAAFDELA--AA--GLHLEDLDLKAVGHRMVHGGKTFYKPSVVDDELIAKARELSPLAPLHNPPAIKGIEVARKLLPDLPHIAVFDTAFFHDLPAPASTYAIDRELAETWHIKRYGFHGTSHEYVSQQAAIFLDRPLESLNQIVLHLGNGASASAVAGGKAVDTSMGLTPMEGLVMGTRSGDIDPGVIMYLWRTAGMSVDDIESMLNRRSGVLGLGG-ASDFRKLRELI--ESGDEH--AKLAYDVYIHRLRKYIGAYMAVLGRTDVISFTAGVGENVPPVRRDALAGLGGLGIEIDDALNSA---K--SDE--P-RLISTPDSRVTVLVVPTNEELAIAR--------
57 Fugue 82.7352% 2 - C8 - - 1G99 ACKA_METTE A:[1-398] -MKVLVINAGSSSLKYQLIDMTNESALAV-GLCERIGIDNSIITQKKFDGKKLEKLTDLPTHKDALEEVVKALTDDEF--GVIKDMGEINAVGHRVVHGGEKFTTSALYDEGVEKAIKDCFELAPLHNPPNMMGISACAEIMPGTPMVIVFDTAFHQTMPPYAYMYALPYDLYEKHGVRKYGFHGTSHKYVAERAALMLGKPAEETKIITCHLGNGSSITAVEGGKSVETSMGFTPLEGLAMGTRCGSIDPAIVPFLMEKEGLTTREIDTLMNKKSGVLGVSGLSNDFRDLDEAA--SKGNRK--AELALEIFAYKVKKFIGEYSAVLNGADAVVFTAGIGENSASIRKRILTGLDGIGIKIDDEKNKI---R--GQE--I-D-ISTPDAKVRVFVIPTNEELAIARETKEIVET
2 PsiBlast_PDB 82.1852% 3 - C8 - - 1G99 ACKA_METTE A:[2-395] --KVLVINAGSSSLKYQLIDMTNESALAV-GLCERIGIDNSIITQKKFDGKKLEKLTDLPTHKDALEEVVKALTDDEF--GVIKDMGEINAVGHRVVHGGEKFTTSALYDEGVEKAIKDCFELAPLHNPPNMMGISACAEIMPGTPMVIVFDTAFHQTMPPYAYMYALPYDLYEKHGVRKYGFHGTSHKYVAERAALMLGKPAEETKIITCHLGNGSSITAVEGGKSVETSMGFTPLEGLAMGTRCGSIDPAIVPFLMEKEGLTTREIDTLMNKKSGVLGVSGLSNDFRDLDEAA--SKGNRK--AELALEIFAYKVKKFIGEYSAVLNGADAVVFTAGIGENSASIRKRILTGLDGIGIKIDDEKNKI---R--GQE--I-D-ISTPDAKVRVFVIPTNEELAIARETKEI---
4 PsiBlast_PDB 81.9352% 5 - C8 - - 1TUY ACKA_METTE A:[2-395] --KVLVINAGSSSLKYQLIDMTNESALAV-GLCERIGIDNSIITQKKFDGKKLEKLTDLPTHKDALEEVVKALTDDEF--GVIKDMGEINAVGHRVVHGGEKFTTSALYDEGVEKAIKDCFELAPLHNPPNMMGISACAEIMPGTPMVIVFDTAFHQTMPPYAYMYALPYDLYEKHGVRKYGFHGTSHKYVAERAALMLGKPAEETKIITCHLGNGSSITAVEGGKSVETSMGFTPLEGLAMGTRCGSIDPAIVPFLMEKEGLTTREIDTLMNKKSGVLGVSGLSNDFRDLDEAA--SKGNRK--AELALEIFAYKVKKFIGEYSAVLNGADAVVFTAGIGENSASIRKRILTGLDGIGIKIDDEKNKI---R--GQE--I-D-ISTPDAKVRVFVIPTNEELAIARETKEI---
46 HHSearch 81.1353% 2 - C8 - - 1G99 ACKA_METTE B:[1-396] -MKVLVINAGSSSLKYQLIDMTNESALAV-GLCERIGIDNSIITQKKFDGKKLEKLTDLPTHKDALEEVVKALT--DDEFGVIKDMGEINAVGHRVVHGGEKFTTSALYDEGVEKAIKDCFELAPLHNPPNMMGISACAEIMPGTPMVIVFDTAFHQTMPPYAYMYALPYDLYEKHGVRKYGFHGTSHKYVAERAALMLGKPAEETKIITCHLGNGSSITAVEGGKSVETSMGFTPLEGLAMGTRCGSIDPAIVPFLMEKEGLTTREIDTLMNKKSGVLGVSGLSNDFRDLDEAASKGN--RK--AELALEIFAYKVKKFIGEYSAVLNGADAVVFTAGIGENSASIRKRILTGLDGIGIKIDDEKNKI---R--GQE--I-D-ISTPDAKVRVFVIPTNEELAIARETKEIV--
48 HHSearch 80.9753% 5 - C8 - - 1TUU ACKA_METTE A:[1-396] -MKVLVINAGSSSLKYQLIDMTNESALAV-GLCERIGIDNSIITQKKFDGKKLEKLTDLPTHKDALEEVVKALT--DDEFGVIKDMGEINAVGHRVVHGGEKFTTSALYDEGVEKAIKDCFELAPLHNPPNMMGISACAEIMPGTPMVIVFDTAFHQTMPPYAYMYALPYDLYEKHGVRKYGFHGTSHKYVAERAALMLGKPAEETKIITCHLGNGSSITAVEGGKSVETSMGFTPLEGLAMGTRCGSIDPAIVPFLMEKEGLTTREIDTLMNKKSGVLGVSGLSNDFRDLDEAASKGN--RK--AELALEIFAYKVKKFIGEYSAVLNGADAVVFTAGIGENSASIRKRILTGLDGIGIKIDDEKNKI---R--GQE--I-D-ISTPDAKVRVFVIPTNEELAIARETKEIV--
21 PsiBlast_CBE 80.7152%