@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr0546: (2017-12-24 )
MKFLELNKKRHATKHFTDKPVDPKDVRTAIEIATLAPSAHNSQPWKFVVVREKNAELAKLAYGSNFEQVSSAPVTIALFTDTDLAKRARKIARVGGANNFSEEQLQYFMKNLPAEFARYSEQQVSDYLALNAGLVAMNLVLALTDQGIGSNIILGFDKSKVNEVLEIEDRFRPELLITVGYTDDKLEPSYRLPVDEIIEKR

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMN_A_5(2B67)
?
[Raw transfer]




FMN_A_5(2B67)
?
[Raw transfer]




UNL_A_6(3GBH)
?
[Raw transfer]




1 PsiBlast_PDB 86.9298% -97 - C2 -2B67 6.3 ?
83 HHSearch 75.9595% -2 - C2 -2B67 6.3 ?
7 PsiBlast_PDB 58.9923%-137 - C3 -3GE5 - ? -
6 PsiBlast_PDB 57.8529% -65 - C3 -1NOX - NOX_THET8 -
94 HHSearch 54.3322% -16 - C2 -4QLX - ? -
95 HHSearch 54.1822% -15 - C2 -4QLX - ? -
87 HHSearch 52.9219% -78 - C2 -5HDJ - ? -
11 PsiBlast_PDB 52.5322% -59 * C3 *3H4O - ? -
84 HHSearch 52.5224% -15 - C2 -3GAG - ? -
85 HHSearch 52.2724% -16 - C2 -3GAG - ? -
5 PsiBlast_PDB 52.1228% -10 - C2 -3BEM - MHQN_BACSU -
15 PsiBlast_PDB 51.4727% -26 - C3 -4QLY - ? -
12 PsiBlast_PDB 51.4322% -54 - C3 -3KOQ - ? -
92 HHSearch 51.3421% -92 - C2 -5UU6 - ? -
96 HHSearch 51.0125% 28 - C2 -3BEM - MHQN_BACSU -
91 HHSearch 50.9320% -92 - C2 -3EOF - ? -
2 PsiBlast_PDB 50.7530% 16 - C2 -3GE6 - ? -
14 PsiBlast_PDB 50.4927% -22 - C3 -4QLX - ? -
90 HHSearch 50.4619% -74 - C2 -3N2S - NFRA1_BACSU -
3 PsiBlast_PDB 50.3829%-106 - C3 -4DN2 - ? -