@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VKT5: (2017-10-29 )
MIVIAMGVCGTGKTLIGELLSERLACEFLDGDTLHSAANKSKMSQGIPLTDEDRLPWLQAIRQAIEAKQRDGETAVFTCSSLKRMYRDILRGQDQNVKFVYLKGSYELLQQRLAERSGHFFDPALLQNQLDTLEEPDVNEAIAIDIALTPEQIIEQVIQKLGVTDSVCRG

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

6PG_A_3(1KO8)
GNTK_ECOLI
[Raw transfer]




6PG_B_4(1KO8)
GNTK_ECOLI
[Raw transfer]




1 PsiBlast_PDB 84.0042%-101 - C2 -4EUN - ? -
23 PsiBlast_CBE 81.9841%-113 - C2 -1KO5 - GNTK_ECOLI -
41 HHSearch 81.8341%-103 - C2 -4EUN - ? -
6 PsiBlast_PDB 80.8041%-113 - C2 -1KOF - GNTK_ECOLI -
21 PsiBlast_CBE 80.2941%-108 - C2 -1KOF - GNTK_ECOLI -
5 PsiBlast_PDB 79.9341%-115 - C2 -1KO8 3.2 GNTK_ECOLI
4 PsiBlast_PDB 79.8541%-108 - C2 -1KO5 - GNTK_ECOLI -
2 PsiBlast_PDB 79.0141%-111 - C2 -1KNQ - GNTK_ECOLI -
22 PsiBlast_CBE 77.3141%-109 - C2 -1KO8 2.9 GNTK_ECOLI
42 HHSearch 75.1440% -27 - C2 -1KO5 - GNTK_ECOLI -
3 PsiBlast_PDB 74.5441%-114 - C2 -1KO1 - GNTK_ECOLI -
7 PsiBlast_PDB 74.1340%-108 - C2 -1KO4 - GNTK_ECOLI -
45 HHSearch 73.3441% -59 * C2 *3T61 - ? -
43 HHSearch 72.6640% -28 - C2 -1KNQ - GNTK_ECOLI -
61 Fugue 67.0340% 48 - C2 -1KNQ - GNTK_ECOLI -
8 PsiBlast_PDB 65.8940% -48 - C2 -3T61 - ? -
48 HHSearch 52.4720% 17 - C2 -2VLI - ? -
54 HHSearch 51.3318% -75 - C2 -3VAA - AROK_BACTN -
44 HHSearch 50.6012% -78 - C2 -2RHM - ? -
9 PsiBlast_PDB 50.2325%-129 - C2 -2YVU - CYSC_AERPE -