@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VL13: (2017-10-30 )
MTAQMKTNASAKKAVNSPNHIYDTFIVGAGISGIAAAIRLDQVGYTNYKIIEKAGRVGGTWRENTYPGCGCDVPSALYSYSFAPSAKWGHLFARQPEILSYLEDVSNEFNITSKIEFYNELLNAAWDESRHLWVLDTTTGQYLSRTVIFATGPITEAQIPRLEGLDTFTGEMFHSAKWNHDYDLTGKRIAVIGTGASAIQFVPQIQPKAKELFVFQRTAPWVLPKPDTDLGELSKSIIAKYPAIQASWRKSVALTLNAINFGLRNPLALKPVNVLGKQLLKLQIADPELRKNVTPNFDIGCKRILFANNYYPALQAPNTTLIPHGLVKVEGNTVIAANGERHEVDVIIWGTGFEVSHPPIGKRVFNEKGQRLNDLWKNSSPEAYLGTNIENVPNAFLVLGPNVLVYDSFIGLAEAQLDYIVDGLLKIKNKGISKLNVKADVIKKHNDLVQKHLQTTVFNSGGCKSYYLDANGRNFAAWPWSLKKLKQRLKKLDLKDYEVTYQMSKTH

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAP_A_3(2YLS)
PAMO_THEFY
[Raw transfer]




N01_A_3(4OVI)
PAMO_THEFY
[Raw transfer]




NA7_A_3(5M0Z)
?
[Raw transfer]




1 PsiBlast_PDB 100.0031% 0 - C- -4AP3 - ? -
122 Fugue 74.6529% -1 - C1 -1W4X - PAMO_THEFY -
2 PsiBlast_PDB 72.8228% 3 - C1 -1W4X - PAMO_THEFY -
6 PsiBlast_PDB 72.7828% 5 - C1 -4C74 - PAMO_THEFY -
7 PsiBlast_PDB 72.6528% 4 - C1 -4OVI 9.9 PAMO_THEFY
3 PsiBlast_PDB 72.5328% 4 - C1 -2YLR - PAMO_THEFY -
13 PsiBlast_PDB 72.3427% 6 - C1 -2YLX - PAMO_THEFY -
111 HHSearch 72.1129% -1 - C1 -4AP1 - ? -
5 PsiBlast_PDB 72.0428% 1 - C1 -2YLT - PAMO_THEFY -
4 PsiBlast_PDB 72.0328% 3 - C1 -2YLS 10.0 PAMO_THEFY
10 PsiBlast_PDB 71.9427% 5 - C1 -2YM1 - PAMO_THEFY -
8 PsiBlast_PDB 71.9228% 3 - C1 -2YLZ - PAMO_THEFY -
15 PsiBlast_PDB 71.5927% 5 - C1 -4D04 - PAMO_THEFY -
14 PsiBlast_PDB 71.1527% 5 - C1 -4D03 - PAMO_THEFY -
12 PsiBlast_PDB 71.1227% 5 - C1 -4C77 - PAMO_THEFY -
9 PsiBlast_PDB 70.9527% 6 - C1 -2YLW - PAMO_THEFY -
11 PsiBlast_PDB 70.8227% 9 - C1 -2YM2 - PAMO_THEFY -
110 HHSearch 70.6829% 3 - C1 -4AP3 - ? -
102 HHSearch 70.5228% 8 * C1 *2YLR - PAMO_THEFY -
103 HHSearch 70.4128% 9 - C1 -1W4X - PAMO_THEFY -