@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VLB6: (2017-11-01 )
MIDSEGFRPNVGIILANDDGQVLWAKRIGHNAWQFPQGGIQFGETPEQALFRELREEIGLLPEHVQIIAQTKGWLRYRLPHRYIRSDSDPVCIGQKQKWFLLKLTAPAKNIQLNLADPPEFDEWQWVSYWYPLGQVVNFKRDVYRKAMVELCTQLPVQQLP

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_2(1JKN)
?
[Raw transfer]




NACID_B_2(4S2X)
RPPH_ECOLI
[Raw transfer]

-

NACID_B_2(4S2X)
RPPH_ECOLI
[Raw transfer]

-

NACID_B_2(4S2Y)
RPPH_ECOLI
[Raw transfer]

-

4 PsiBlast_PDB 93.3258%-108 - C1 -2KDV - RPPH_ECOLI -
133 HHSearch 91.2858%-110 * C1 *4S2X 7.9 RPPH_ECOLI
3 PsiBlast_PDB 89.9358%-112 - C1 -4S2Y 5.8 RPPH_ECOLI
2 PsiBlast_PDB 89.7558%-104 - C1 -4S2X 7.9 RPPH_ECOLI
1 PsiBlast_PDB 88.1958%-110 - C1 -4S2W - RPPH_ECOLI -
134 HHSearch 87.2357%-100 - C1 -2KDW - RPPH_ECOLI -
5 PsiBlast_PDB 84.5058%-123 - C1 -4S2V - RPPH_ECOLI -
6 PsiBlast_PDB 82.5058% -94 - C1 -2KDW - RPPH_ECOLI -
7 PsiBlast_PDB 71.0340% -2 - C1 -1F3Y - ? -
8 PsiBlast_PDB 67.7840% 2 - C1 -1JKN 5.0 ?
124 Fugue 65.8239% 65 - C1 -1F3Y - ? -
125 Fugue 64.7440% 67 - C1 -1F3Y - ? -
128 Fugue 49.7418% -53 - C1 -4ZBP - NUDT7_ARATH -
146 HHSearch 49.5513% -81 - C1 -3O8S - ? -
145 HHSearch 47.3716% -76 - C1 -4HFQ - ? -
19 PsiBlast_PDB 46.6824% - - C- -4KYX - ? -
150 HHSearch 46.5719% 46 - C1 -2FML - ? -
136 HHSearch 45.2223% - - C1 -4KYX - ? -
143 HHSearch 44.7018% -1 - C1 -2DUK - NUDT4_MOUSE -
144 HHSearch 43.9818% -8 - C1 -3GZ5 - ? -