@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VLC1: (2017-11-01 )
MNSTQQWQSVTWFEVDEHQAGQRIDNFLFSRLKGVPKSRIYRLIREGQVRVNKKRIKAETKLAIGDQIRVAPIRYEQKDETAAPVSDSVAQGLLSRVVYEDEGLLVVNKPSGIAVHGGSGVAYGLIEALRAATGKKYLELIHRIDRDTSGLVMISKKRSTLKLLQDMLREHKIRKTYAAIVKGQVSLDKQLIDAPLFRYELANGERRVRVSKEGKPSKTEWVVAERFKNATLVHASPLSGRTHQIRVHGLSIGHPLVGDDKYGHNTAYTGPEARRLCLHAMRLDIPGYPTIEAPLPEDMTQLLEALRVAK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACY_E_5(1XPI)
RLUC_ECOLI
[Raw transfer]




ACY_G_7(1XPI)
RLUC_ECOLI
[Raw transfer]




GOL_A_7(5VBB)
RUSD1_HUMAN
[Raw transfer]




2 PsiBlast_PDB 78.4348% -2 - C7 -1V9K - RLUC_ECOLI -
26 HHSearch 76.9550% 5 - C7 -1V9K - RLUC_ECOLI -
15 Fugue 76.7830% -17 - C7 -2IST - RLUD_ECOLI -
4 PsiBlast_PDB 76.5831% 8 - C7 -2IST - RLUD_ECOLI -
14 PsiBlast_CBE 76.3548% 6 - C7 -1XPI 2.7 RLUC_ECOLI
1 PsiBlast_PDB 75.6348% 0 - C7 -1XPI 2.8 RLUC_ECOLI
29 HHSearch 69.7829% -24 - C7 -5UBA - RUSD4_HUMAN -
7 PsiBlast_PDB 67.7231% -5 - C7 -1PRZ - RLUD_ECOLI -
3 PsiBlast_PDB 66.4431% -10 - C7 -1V9F - RLUD_ECOLI -
5 PsiBlast_PDB 65.8030% -6 - C7 -1QYU - RLUD_ECOLI -
31 HHSearch 64.9334% -0 - C7 -2I82 - RLUA_ECOLI -
32 HHSearch 64.8834% -1 - C7 -2I82 - RLUA_ECOLI -
6 PsiBlast_PDB 64.8734% -64 - C7 -2I82 - RLUA_ECOLI -
28 HHSearch 64.1328% -44 - C7 -5VBB - RUSD1_HUMAN -
27 HHSearch 64.0233% 9 - C7 -1PRZ - RLUD_ECOLI -
25 HHSearch 63.9532% 2 - C7 -1V9F - RLUD_ECOLI -
9 PsiBlast_PDB 60.2127% -3 - C7 -5VBB 3.4 RUSD1_HUMAN
8 PsiBlast_PDB 55.6128% -33 - C7 -5UBA - RUSD4_HUMAN -
35 HHSearch 51.0220% -84 - C7 -3DH3 - RLUF_ECOLI -
30 HHSearch 50.1221% -6 - C7 -1KSK - RSUA_ECOLI -