@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VLH9: (2017-11-02 )
MKLYYSPGACSLAAHIILNEINVDFDLERVNLKTHKTEKGADYYEINPKGYVPALEINPGLILTENVAILPFLAQHDPKQDLIPPSGLGRAKVLEWLGYLNSELHDAYAVFFGAPLTNDEKTKAYAEIDRLLKYIDNYLAESDYDYLVNDNFGPADAYLFVLTNWSNSIEHDLTPYKHIIALRNKVAERQSVQIAMRDEGLIS

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

HPX_D_12(2DSA)
?
[Raw transfer]




HPX_D_12(2DSA)
?
[Raw transfer]




HPX_B_10(2DSA)
?
[Raw transfer]




HPX_A_9(2DSA)
?
[Raw transfer]




6 PsiBlast_PDB 80.6441% -97 - C2 -1PMT - GST_PROMI -
1 PsiBlast_PDB 80.3544% -93 - C2 -4G9H - ? -
2 PsiBlast_PDB 78.4944% -90 - C2 -4GCI - ? -
5 PsiBlast_PDB 77.1241% -94 - C2 -2PMT - GST_PROMI -
3 PsiBlast_PDB 76.9642% -97 - C2 -3UAP - ? -
4 PsiBlast_PDB 76.2042% -91 - C2 -3UAR - ? -
12 PsiBlast_PDB 75.9340%-100 - C2 -4KGI - ? -
14 PsiBlast_PDB 75.1840% -93 - C2 -1N2A - GSTA_ECOLI -
9 PsiBlast_PDB 74.1740% -85 - C2 -2NTO - GST_OCHAN -
31 PsiBlast_CBE 74.1339% -83 - C2 -2DSA 4.0 ?
67 HHSearch 74.1139% -86 - C2 -1F2E - ? -
78 HHSearch 73.8340% -84 - C2 -2DSA 4.0 ?
32 PsiBlast_CBE 73.7439% -85 - C2 -2DSA - ? -
8 PsiBlast_PDB 73.5539% -85 - C2 -2DSA 3.9 ?
87 HHSearch 73.5441% -65 * C2 *1N2A - GSTA_ECOLI -
7 PsiBlast_PDB 73.4539% -88 - C2 -2GDR - ? -
73 HHSearch 73.0141% -40 - C2 -1PMT - GST_PROMI -
83 HHSearch 72.6541% -51 - C2 -4KGI - ? -
11 PsiBlast_PDB 72.6139% -81 - C2 -2PVQ - GST_OCHAN -
74 HHSearch 72.5541% -32 - C2 -2PMT - GST_PROMI -
33 PsiBlast_CBE 72.0139% -84 - C2 -2DSA 3.7 ?