@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VLN3: (2017-11-03 )
MAALMCFSSLAQAYQYEQTARLINERLSYMKDVAGYKAEQHLPIEDLTQEKKVLDQSLSEADAFGLNSETVKPFIVAQMDVAKAIQYRYRADWLSSPETNWKPQDLSEVRVKISALNTELLKNIAYELKKNNNKAPHGCSYMWPVQHPQLKEADKRALCVTLNKIKLKQ

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CIT_B_19(2GBB)
SCMU_YERPE
[Raw transfer]




EDO_C_16(4OJ7)
?
[Raw transfer]




29 HHSearch 86.9352% -28 - C3 -2GBB 4.0 SCMU_YERPE
30 HHSearch 84.4952% -15 - C- -2GBB - SCMU_YERPE -
1 PsiBlast_PDB 81.5851% -16 - C- -2GBB - SCMU_YERPE -
21 Fugue 72.9951% 36 - C- -2GBB - SCMU_YERPE -
31 HHSearch 67.2220% -29 - C3 -4OJ7 - ? -
32 HHSearch 66.5820% -20 - C3 -4OJ7 2.6 ?
36 HHSearch 64.1426% -4 - C3 -2FP1 - SCMU_MYCTU -
35 HHSearch 63.9926% -13 - C3 -2AO2 - SCMU_MYCTU -
22 Fugue 60.9619% 1 - C3 -4OJ7 - ? -
7 PsiBlast_PDB 60.0924% -21 - C3 -4OJ7 - ? -
34 HHSearch 59.2620% -21 - C3 -5TS9 - ? -
33 HHSearch 58.3820% -18 - C3 -5TS9 - ? -
38 HHSearch 54.0917% -91 * C3 *1ECM - PHEA_ECOLI -
2 PsiBlast_PDB 53.1530% 29 - C3 -2F6L - SCMU_MYCTU -
4 PsiBlast_PDB 52.4130% 28 - C3 -2FP2 - SCMU_MYCTU -
5 PsiBlast_PDB 51.9430% 37 - C3 -2AO2 - SCMU_MYCTU -
37 HHSearch 51.6917% -79 - C3 -1ECM - PHEA_ECOLI -
3 PsiBlast_PDB 51.5330% 36 - C3 -2FP1 - SCMU_MYCTU -
6 PsiBlast_PDB 49.0224% 10 - C3 -5TS9 - ? -
23 Fugue 48.8315% -76 - C3 -1ECM - PHEA_ECOLI -