@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VMD8: (2017-11-07 )
MSIVERPSYTSKDVEVTSREPLFSGFIQVEKVSLRHRLFNQSEYTPVLQRELVHRPEAAGVLLYNDQKQQFALIEQFRVGALDDSHSPWQLEIIAGVLDGNESPESCIRCESLEESGCEVQDLEHLFSFYPSAGACSELFHLYVAETNLPAVGGVFGVDNEGENIQLHLFSYSEIQTLLNSGRLRNAPVIMALQWLAQHSKTIINPKR

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GDD_B_8(3O61)
NUDK_ECOLI
[Raw transfer]




GDD_C_10(3O61)
NUDK_ECOLI
[Raw transfer]




TAR_D_14(3O52)
NUDK_ECOLI
[Raw transfer]




54 HHSearch 93.6134%-122 - C4 -1G0S - ADPP_ECOLI -
1 PsiBlast_PDB 92.9634%-122 - C4 -1G0S - ADPP_ECOLI -
3 PsiBlast_PDB 92.7834%-111 - C4 -1GA7 - ADPP_ECOLI -
21 PsiBlast_CBE 92.5534%-106 - C4 -1KHZ - ADPP_ECOLI -
23 PsiBlast_CBE 92.1134%-119 - C4 -1G9Q - ADPP_ECOLI -
4 PsiBlast_PDB 90.9934%-112 - C4 -1KHZ - ADPP_ECOLI -
5 PsiBlast_PDB 90.9234%-106 - C4 -1VIQ - ADPP_ECOLI -
53 HHSearch 90.1134%-111 * C4 *1G9Q - ADPP_ECOLI -
2 PsiBlast_PDB 89.9934%-111 - C4 -1G9Q - ADPP_ECOLI -
74 Fugue 82.3333% -13 - C4 -1G0S - ADPP_ECOLI -
8 PsiBlast_PDB 65.8736% -54 - C4 -3O6Z - NUDK_ECOLI -
29 PsiBlast_CBE 65.4635% -25 - C4 -3O69 - NUDK_ECOLI -
25 PsiBlast_CBE 64.5236% -47 - C4 -3O52 3.0 NUDK_ECOLI
10 PsiBlast_PDB 64.4535% -47 - C4 -3O69 - NUDK_ECOLI -
28 PsiBlast_CBE 63.9336% -27 - C4 -3O6Z - NUDK_ECOLI -
27 PsiBlast_CBE 63.8536% -69 - C4 -3O52 - NUDK_ECOLI -
31 PsiBlast_CBE 63.7135% -45 - C4 -3O61 2.6 NUDK_ECOLI
7 PsiBlast_PDB 63.6136% -41 - C4 -1VIU - NUDK_ECOLI -
9 PsiBlast_PDB 63.5935% -37 - C4 -3O61 - NUDK_ECOLI -
32 PsiBlast_CBE 63.4135% -36 - C4 -3O61 3.1 NUDK_ECOLI