@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VMR2: (2017-11-10 )
MKKLAIIGSGGFAKELLDLAIDQGYHQICFLERNAKDGDALLGFPILAESVIPTLTDTIYAIGVADPKIRKRIYETYPDLTYPNLIHSQASLGYGIRELLEDSKGIVIAAGARITNSCRFGNFIIVSFNSTIGHDCILENYVSIMPGANISGCVHLMQGTYVGTNVAVLPGKNPELLKCLGENSVIGAGAVVVKHTEPNKVYIGSPAKELRRD

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACO_C_7(4M99)
?
[Raw transfer]




58 HHSearch 81.1924%-119 - C5 -4EA9 - ? -
59 HHSearch 79.5524%-113 - C5 -4EAA - ? -
61 HHSearch 75.9731% -31 - C5 -4M99 - ? -
60 HHSearch 75.3031% -32 - C- -4M98 - ? -
6 PsiBlast_PDB 73.5327% -85 - C5 -3BSS - PGLD_CAMJE -
76 Fugue 73.3325% -16 - C5 -4EAB - ? -
5 PsiBlast_PDB 73.1827% -86 - C5 -2VHE - PGLD_CAMJE -
8 PsiBlast_PDB 72.9327% -81 - C5 -3BSY - PGLD_CAMJE -
57 HHSearch 72.1428% -70 - C5 -2VHE - PGLD_CAMJE -
9 PsiBlast_PDB 71.8227% -78 - C5 -5T2Y - PGLD_CAMJE -
62 HHSearch 71.6324% -37 - C5 -4M9C - ? -
56 HHSearch 70.0428% -73 - C5 -3BFP - PGLD_CAMJE -
1 PsiBlast_PDB 69.8830% -8 - C5 -4M99 4.4 ?
11 PsiBlast_PDB 68.8925% -66 - C- -4M9C - ? -
2 PsiBlast_PDB 68.8730% -9 - C- -4M98 - ? -
77 Fugue 67.8528% -70 - C5 -3BFP - PGLD_CAMJE -
7 PsiBlast_PDB 67.3127% -82 - C5 -3BSW - PGLD_CAMJE -
4 PsiBlast_PDB 67.1127% -82 - C5 -3BFP - PGLD_CAMJE -
10 PsiBlast_PDB 65.8027% -79 - C5 -5TYH - PGLD_CAMJE -
3 PsiBlast_PDB 64.7526% -82 - C5 -2NPO - PGLD_CAMJE -