@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VMX8: (2017-11-11 )
MQMNTQREQLIHTWLTSVLENDQFQIAYLAGDASFRRYACIQLQNKTYMLMDAPPEKEDCVPFVTIDEFFAGHGVRVPQIVAKDLNQGFLLLEDFGDVLLSTLLNDETVDQYYEQSFKQLIHLQSINGAEHFLAYSYEKLLSEMQLLTDWMLPSLDIHPTAEQKKTIDDAFDFLAQAALAQPQVIVHRDFHSRNLMKIANEEELGVIDFQDAVIGADTYDLISITRDAYVQWNAERVYQWFKVFYELLPASARQNRSFDQFKRDADLMAIQRHIKILGIFVRLFERDGKSGYLKDLPRVMWYLLEESRGYHELDDFMAFIHSSVMPKFIEKYGPYEVAA

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_A_16(3CSV)
?
[Raw transfer]




35 HHSearch 75.1128% -30 - C1 -3CSV - ? -
1 PsiBlast_PDB 71.8832% -14 - C1 -3CSV 3.3 ?
25 Fugue 67.1227% -8 - C1 -3CSV - ? -
32 Fugue 44.0612% 21 - C1 -1NW1 - CKA2_CAEEL -
39 HHSearch 42.1215% -47 * C1 *2PPQ - KHSE_AGRFC -
28 Fugue 41.7214% -33 - C1 -2PPQ - KHSE_AGRFC -
47 HHSearch 41.1811% -16 - C1 -5FUT - CHKA_HUMAN -
23 PsiBlast_CBE 39.9437%-139 * C2 *1XAI - AROB_STAAR -
8 PsiBlast_PDB 39.9337%-138 - C2 -1XAI - AROB_STAAR -
7 PsiBlast_PDB 39.8437%-126 - C2 -1XAH - AROB_STAAR -
33 Fugue 39.6316% 1 - C1 -1J7L - KKA3_ENTFL -
24 PsiBlast_CBE 39.6037%-138 - C2 -1XAH - AROB_STAAR -
46 HHSearch 39.5611% -9 - C1 -5FTG - CHKA_HUMAN -
27 Fugue 38.7112% 10 - C1 -1ZYL - SRKA_ECOLI -
52 HHSearch 38.4615% -12 - C1 -1NW1 - CKA2_CAEEL -
6 PsiBlast_PDB 38.4337%-137 - C2 -1XAG - AROB_STAAR -
9 PsiBlast_PDB 38.2237%-122 - C2 -1XAJ - AROB_STAAR -
22 PsiBlast_CBE 38.0837%-121 - C2 -1XAJ - AROB_STAAR -
26 Fugue 37.1712% 18 - C1 -2OLC - MTNK_BACSU -
53 HHSearch 36.5515% -9 - C1 -1NW1 - CKA2_CAEEL -