@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VNX9: (2017-11-18 )
MSYFGTDGIRGKFGQMPITPEFALKLGFAAGKVLKRTSPKNKPLVVLGKDTRLSGYILESALQAGLNAAGVYVHLLGPLPTPAIAHLTRALHAHAGIVISASHNPYFDNGIKFFSSEGKKLPDSLQEEINKELEKDLFIEDTANLGKSVRVTDANGRYIEFCKSTFPYHFDLNNLKIVVDCAHGAAYSVGPSVFRELGAKVVALYNEPDGLNINENCGSTHPESLQKAVVEHGADLGIAFDGDADRVVMVDKFGNLIDGDHILYILATQAKNKPAGVVGTVMSNMALEVALEKANVGFVRAKVGDRYVLQALEENGWVTGGEPSGHILTLDKSTTGDAIIAALQVLTVMVEQNKALHELVHDFKLYPQVLVNVRLEQMLDPYSIPALVAEFNKAEEQLKGRGRILIRKSGTEPVIRVMVEGDNEQEVKTLAEHLANAVRSQAQVA

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TLA_A_3(4MRQ)
ALGC_PSEAE
[Raw transfer]



TLA_X_3(1K2Y)
ALGC_PSEAE
[Raw transfer]



GOL_A_9(3UW2)
?
[Raw transfer]
24 HHSearch 97.4443% -31 - C1 -3PDK - GLMM_BACAN -
1 PsiBlast_PDB 96.1543% -33 - C1 -3PDK - GLMM_BACAN -
23 HHSearch 94.3443% -26 - C1 -3PDK - GLMM_BACAN -
2 PsiBlast_PDB 84.0542% 5 - C1 -3I3W - GLMM_FRATT -
21 HHSearch 80.2542% 13 - C1 -3I3W - GLMM_FRATT -
22 HHSearch 79.8142% 12 - C1 -3I3W - GLMM_FRATT -
6 PsiBlast_PDB 79.4826% -29 - C1 -1K2Y 2.9 ALGC_PSEAE
12 PsiBlast_PDB 78.9726% -28 - C1 -2FKF - ALGC_PSEAE -
15 PsiBlast_PDB 78.9626% -30 - C1 -1K35 - ALGC_PSEAE -
17 PsiBlast_PDB 78.7026% -28 - C1 -3BKQ - ALGC_PSEAE -
10 PsiBlast_PDB 78.6026% -27 - C1 -1PCM - ALGC_PSEAE -
4 PsiBlast_PDB 78.5327% -26 - C1 -4MRQ 3.7 ALGC_PSEAE
7 PsiBlast_PDB 78.4426% -27 - C1 -1P5D - ALGC_PSEAE -
9 PsiBlast_PDB 78.4226% -28 - C1 -1PCJ - ALGC_PSEAE -
11 PsiBlast_PDB 77.9426% -26 - C1 -2FKM - ALGC_PSEAE -
16 PsiBlast_PDB 77.9326% -26 - C1 -4IL8 - ALGC_PSEAE -
14 PsiBlast_PDB 77.7726% -26 - C1 -2H5A - ALGC_PSEAE -
8 PsiBlast_PDB 77.7526% -26 - C1 -1P5G - ALGC_PSEAE -
18 PsiBlast_PDB 77.7426% -27 - C1 -3C04 - ALGC_PSEAE -
13 PsiBlast_PDB 77.3526% -28 - C1 -2H4L - ALGC_PSEAE -