@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VP17: (2017-11-19 )
MQADFLNFYEKLNKRRAIVSESYLSGAELIKQIQKSPYSRDLIGYHGQPPEVKWPNNAKVAVQFVLNYEEGGEKHIEHGDEGSEQFLSEIIGAASYPAKHMSMDSMYEYGSRAGFWRIHSEFQRRKLPMTIFGVAMALVRNPYIVEAIKQADYDVVSHGCRWLHYQETDLEVEEQHMEQALSVLENLFGNKTIGWYTGRDSPNTRQLLAEFPQIQYDSDYYGDDLPFWTTLTDTAGASRPHLIIPYTLECNDMKFCSPGGFNSSEQFFQYLKDSFDVLYAEGETAPKMMSIGMHCRILGRPGRFKALQRFLDYIEMHDRVWVCRRQDIAEYWYKNHINQ

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

5AC_A_3(3CL8)
?
[Raw transfer]




5AC_B_4(3CL8)
?
[Raw transfer]




5AC_B_4(3CL8)
?
[Raw transfer]




1 PsiBlast_PDB 99.1060% -99 - C3 -3S6O - ? -
13 HHSearch 98.9259% -98 - C3 -3S6O - ? -
10 PsiBlast_CBE 98.9060% -98 - C3 -3S6O - ? -
9 PsiBlast_CBE 98.0460%-100 - C3 -3S6O - ? -
12 HHSearch 97.8359% -99 - C3 -3S6O - ? -
11 PsiBlast_CBE 81.4752% -11 - C3 -3CL8 3.4 ?
5 PsiBlast_PDB 80.6652% -10 - C3 -1Z7A - ? -
14 HHSearch 79.6452% -2 - C3 -3CL8 3.4 ?
3 PsiBlast_PDB 79.2752% -10 - C3 -3CL7 - ? -
4 PsiBlast_PDB 78.5952% -11 - C3 -3CL8 2.7 ?
2 PsiBlast_PDB 78.3452% -13 - C- -3CL6 - ? -
15 HHSearch 76.9752% -3 - C- -3CL6 - ? -
6 PsiBlast_PDB 67.9222% -73 - C3 -3RXZ - ? -
17 HHSearch 62.8522% -19 - C3 -3RXZ - ? -
16 HHSearch 60.8020% -33 - C3 -4LY4 - PGDAE_HELPG -
7 PsiBlast_PDB 54.4221% -33 - C3 -3QBU - PGDAE_HELPG -
8 PsiBlast_PDB 51.5121% -29 - C3 -4LY4 - PGDAE_HELPG -
20 HHSearch 40.3511% -36 - C3 -2Y8U - ? -
28 HHSearch 38.8314% -4 * C3 *4M1B - ? -
30 HHSearch 38.4610% -21 - C3 -5JP6 - ? -