@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VP77: (2017-11-20 )
MNITKSTVANRMQLLKLAGCLEFFIDHFDEMLKNDTPILEILDQLLLAEQNHVTNKKVFNLLKKSNIRYLNSHLMEIDCSNKVGLNKEVLSSFMDCQWIKSKHNLIFTGATGIGKTWLASAFGTHVCKQGLKVLFFDTTELFEEFETASRLGTISLLKKKLLSCQLLILDDFGLSKVRVNWMAHFISVIDKHTDHGSLLITSQYETKIWLNHFEDQTLGEALLDRIIHRAHIFNLQGESMRKKRGKSIAE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_4(5BQ5)
ISTB_GEOSE
[Raw transfer]




ADP_A_2(3ECC)
?
[Raw transfer]




1 PsiBlast_PDB 86.6328%-179 - C5 -5BQ5 6.9 ISTB_GEOSE
128 HHSearch 85.5526%-170 * C5 *5BQ5 - ISTB_GEOSE -
129 HHSearch 85.4626%-170 - C5 -5BQ5 - ISTB_GEOSE -
119 Fugue 71.2827% -34 - C5 -5BQ5 - ISTB_GEOSE -
3 PsiBlast_PDB 65.7827% -47 - C5 -3EC2 - ? -
2 PsiBlast_PDB 64.8726% -33 - C5 -3ECC - ? -
139 HHSearch 63.6719%-145 - C5 -1L8Q - DNAA_AQUAE -
140 HHSearch 63.1319%-143 - C5 -2HCB - DNAA_AQUAE -
132 HHSearch 61.3220%-109 - C5 -2W58 - ? -
131 HHSearch 60.5126% -42 - C5 -3ECC 6.4 ?
7 PsiBlast_PDB 60.3421% -78 - C5 -2W58 - ? -
133 HHSearch 60.1516% -85 - C5 -5HE8 - ? -
134 HHSearch 58.8516% -85 - C5 -5HE9 - ? -
118 Fugue 57.4817% -64 - C5 -2QGZ - ? -
124 Fugue 53.3817% 0 - C- -1QVR - CLPB_THET8 -
127 HHSearch 51.5216% -15 - C5 -2QGZ - ? -
148 HHSearch 47.3014%-146 - C5 -3BOS - ? -
8 PsiBlast_PDB 47.1121% -87 - C5 -4M4W - DNAI_BACSU -
136 HHSearch 46.8615% -19 - C5 -2Z4R - DNAA_THEMA -
125 Fugue 45.8518% 3 - C2 -4QPI - ? -