@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VPL7: (2017-11-22 )
MFSDRFEQLVQALRILPSVGPKSAQRMALHLLMKNREGAFALAHALHEASSYIHECSVCHSLTEHEICDICASTERDDQLLCVVESPADVMAIEQSGSFRGKYHVLGGHLSPLDGIGPEEIGIPYLIQRLSQGTIEEVILATNATVEGQATAHYLVEATKHLPIHMTRIAQGVPQGGELEYVDSHTLSQAVHNRMRMK

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

IMD_A_7(3VE5)
RECR_CALS4
[Raw transfer]




22 PsiBlast_CBE 86.4442%-178 - C6 -3VDP - RECR_CALS4 -
31 HHSearch 86.3942%-178 - C6 -3VDP - RECR_CALS4 -
17 PsiBlast_CBE 86.3750%-164 - C6 -1VDD - RECR_DEIRA -
16 PsiBlast_CBE 86.0650%-164 - C6 -1VDD - RECR_DEIRA -
32 HHSearch 86.0547%-164 - C6 -2V1C - RECR_DEIRA -
2 PsiBlast_PDB 85.8850%-165 - C6 -2V1C - RECR_DEIRA -
6 PsiBlast_PDB 85.7849%-170 - C6 -4JCV - RECR_DEIRA -
30 HHSearch 85.6242%-183 - C6 -3VDP - RECR_CALS4 -
20 PsiBlast_CBE 85.5642%-183 - C6 -3VDP - RECR_CALS4 -
5 PsiBlast_PDB 85.3841%-189 - C6 -4O6O - RECR_CALS4 -
18 PsiBlast_CBE 85.2750%-164 - C6 -1VDD - RECR_DEIRA -
3 PsiBlast_PDB 85.2742%-187 - C6 -3VDP - RECR_CALS4 -
23 PsiBlast_CBE 85.1841%-184 - C6 -4O6O - RECR_CALS4 -
25 PsiBlast_CBE 85.0841%-178 - C6 -4O6O - RECR_CALS4 -
1 PsiBlast_PDB 84.7950%-163 - C6 -1VDD - RECR_DEIRA -
24 PsiBlast_CBE 84.5441%-188 - C6 -4O6O - RECR_CALS4 -
21 PsiBlast_CBE 84.4142%-185 - C6 -3VDP - RECR_CALS4 -
33 HHSearch 84.0247%-162 - C6 -1VDD - RECR_DEIRA -
8 PsiBlast_PDB 83.3341%-169 - C6 -4O6P - RECR_CALS4 -
4 PsiBlast_PDB 82.4841%-168 - C6 -3VDU - RECR_CALS4 -
29 PsiBlast_CBE 81.4143%-160 - C6 -3VE5 3.6 RECR_CALS4