@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VPR5: (2017-11-22 )
MHEYRLIVFIERLNVTIQTEQEFLASYDRRDYDAPLLTVDMAIFSVFNGQLQVLLIKRPNFPAKDQWALPGGFADLTHDQDLMATAYRKLVEKTGISSPYLEQVASVGNAKRDPRGWAVTILYFALIDFNAYQHQALAEYSEWVPVAKAKDLALAFDHNELLSLALERLTSKTRYTALPASLMPELFTLTELQTIYEIILGQSLDKKAFRRRMIEAGAVEETNHSKIVGKRPAQLYRYALDSFDFIFPRSLELPRNKEGEGKQNNELSD

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ARA_A_3(5DEQ)
?
[Raw transfer]




EDO_A_2(5DD4)
?
[Raw transfer]




EDO_A_5(5BS6)
?
[Raw transfer]




GOL_A_2(3I9X)
?
[Raw transfer]




GOL_A_3(2FML)
?
[Raw transfer]




GOL_A_3(2FML)
?
[Raw transfer]




MLA_A_5(5DDG)
?
[Raw transfer]




6 PsiBlast_PDB 87.5137% -99 - C2 -5DDG 2.2 ?
5 PsiBlast_PDB 86.9137% -99 - C2 -5DD4 2.7 ?
4 PsiBlast_PDB 86.1737%-104 - C2 -5BS6 3.9 ?
2 PsiBlast_PDB 86.1444% -63 - C2 -3GZ6 - ? -
7 PsiBlast_PDB 85.2037% -95 - C2 -5DEQ 3.2 ?
1 PsiBlast_PDB 83.7144% -68 - C2 -3GZ5 - ? -
42 HHSearch 81.4135% -82 - C2 -5DEQ - ? -
41 HHSearch 80.6843% -50 - C2 -3GZ5 - ? -
3 PsiBlast_PDB 73.6748% -88 - C2 -3GZ8 - ? -
25 PsiBlast_CBE 72.8648% -86 - C2 -3GZ8 - ? -
24 PsiBlast_CBE 72.4348% -81 - C2 -3GZ8 - ? -
23 PsiBlast_CBE 71.2148% -78 - C2 -3GZ8 - ? -
44 HHSearch 70.7531% 4 - C2 -2FML 2.9 ?
47 HHSearch 68.6446% -76 * C2 *3GZ8 - ? -
8 PsiBlast_PDB 66.6630% 22 - C2 -2FML 2.9 ?
11 PsiBlast_PDB 52.9927% 14 - C2 -2R5W - ? -
10 PsiBlast_PDB 51.5927% 10 - C2 -2QJT - ? -
18 PsiBlast_PDB 51.4425% -83 - C2 -2QJO - NADM_SYNY3 -
48 HHSearch 50.5431% 31 - C2 -3I9X 3.1 ?
32 Fugue 49.7120% -86 - C2 -1K2E - ? -