@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VQD8: (2017-11-26 )
MISYEKTDMNHGTFPVFDGHNDVLTRLWLSDHNNPAQAFIQEGLAGHLDLKRCQQAGFVGGMFAIFLPPFHYVKQHHPNKLFDQDASDFTQQQIEHICLAQLDLAKQLAEYSNDIQICTTVQDIQHCLTQQKLAIILHMEGAEALQHNPDLLDVFYDAGLRSIGPLWNRPSRFGHGLNAKFPHSPDTGAGLTNEGKAFIKRCADKKMVIDVSHMNERAFWDTANILQQPIVATHSNVHALCPQARNLTDNQLKAIKDSKGIVGLNFDVAFLRKDGQRDANTSIEVLLEHLEYLIDQMGENHVGFGSDFDGALISHEIEDVRGLHLLIEAMQKRHYSNEIIEKICFSNWLTVLNRILDK

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LY0_B_6(3LY0)
?
[Raw transfer]




LY0_A_3(3LY0)
?
[Raw transfer]




L3A_B_6(3NEH)
?
[Raw transfer]




L3A_A_3(3NEH)
?
[Raw transfer]




TRS_A_6(5LX7)
?
[Raw transfer]




26 HHSearch 88.0243% -1 - C2 -3LY0 - ? -
27 HHSearch 84.4443% 1 - C2 -3FDG - ? -
1 PsiBlast_PDB 84.4342% -2 - C2 -3FDG - ? -
2 PsiBlast_PDB 84.0942% -1 - C2 -3LY0 3.5 ?
22 PsiBlast_CBE 83.7842% -0 - C2 -3LY0 3.7 ?
24 HHSearch 76.3024% -18 - C2 -3B40 - ? -
33 HHSearch 75.1023% -15 - C2 -5NRY - ? -
34 HHSearch 74.8823% -16 - C2 -5NRT - ? -
31 HHSearch 74.2029% -27 - C2 -3NEH - ? -
16 PsiBlast_PDB 73.0625% -3 - C2 -5LX4 - ? -
25 HHSearch 72.8922% -12 - C2 -2RAG - ? -
8 PsiBlast_PDB 72.4025% -0 - C2 -5NRY - ? -
5 PsiBlast_PDB 72.2125% -2 - C2 -5NRT - ? -
11 PsiBlast_PDB 72.1325% -1 - C2 -5NS2 - ? -
10 PsiBlast_PDB 72.0125% 1 - C2 -5NS1 - ? -
18 PsiBlast_PDB 71.9423% -7 - C2 -3B40 - ? -
9 PsiBlast_PDB 71.8625% -1 - C2 -5NRZ - ? -
7 PsiBlast_PDB 71.6925% -0 - C2 -5NRX - ? -
17 PsiBlast_PDB 71.6625% -5 - C2 -5LX1 - ? -
12 PsiBlast_PDB 71.6325% -2 - C2 -5NS5 - ? -
3 PsiBlast_PDB 61.1532% -24 - C2 -3NEH 3.1 ?
23 PsiBlast_CBE 60.0632% -22 - C2 -3NEH 3.2 ?