@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VQG9: (2017-11-27 )
MNNWNFQELKETPSQTGGPYVHIGLLPQQAGIEVFENNFNNQLVQDQTKGECIRLEGQVFDGLGLPLRDVLIEIWQADANGIYPSQADTREQKADPAFQGWGRTGADFETGVWSFNTIKPGATAGRKGSVQAPHIALVIFARGINLGLHTRVYFEDEAEANANDPILNSIEWAPRRQTLIAKRFEENGEVVYRFDIRIQGDDETVFFDI

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TRS_F_(3LKT)
PCXA_PSEPU
[Raw transfer]




10 PsiBlast_PDB 96.9581% -80 - C6 -2BUU - PCXA_ACIAD -
9 PsiBlast_PDB 96.6281% -77 - C6 -2BUV - PCXA_ACIAD -
8 PsiBlast_PDB 96.4381% -79 - C6 -2BUT - PCXA_ACIAD -
14 PsiBlast_PDB 96.4281% -80 - C6 -2BUY - PCXA_ACIAD -
5 PsiBlast_PDB 96.2881% -79 - C6 -2BUM - PCXA_ACIAD -
7 PsiBlast_PDB 95.9681% -80 - C6 -2BUR - PCXA_ACIAD -
4 PsiBlast_PDB 95.7581% -70 - C6 -1EOC - PCXA_ACIAD -
13 PsiBlast_PDB 95.6981% -77 - C6 -2BUX - PCXA_ACIAD -
6 PsiBlast_PDB 95.5981% -76 - C6 -2BUQ - PCXA_ACIAD -
2 PsiBlast_PDB 95.4581% -74 - C6 -1EOA - PCXA_ACIAD -
3 PsiBlast_PDB 95.4081% -76 - C6 -1EOB - PCXA_ACIAD -
11 PsiBlast_PDB 95.2881% -79 - C6 -2BUW - PCXA_ACIAD -
15 PsiBlast_PDB 95.2281% -81 - C6 -2BUZ - PCXA_ACIAD -
12 PsiBlast_PDB 95.0781% -76 - C6 -1EO9 - PCXA_ACIAD -
16 PsiBlast_PDB 94.8881% -79 - C6 -2BV0 - PCXA_ACIAD -
1 PsiBlast_PDB 94.2281% -69 - C6 -1EO2 - PCXA_ACIAD -
18 PsiBlast_PDB 83.5952% -89 - C6 -3PCF - PCXA_PSEPU -
20 PsiBlast_PDB 83.4552% -86 - C6 -3PCL - PCXA_PSEPU -
29 PsiBlast_CBE 83.3052% -92 - C6 -4WHQ - PCXA_PSEPU -
133 PsiBlast_CBE 83.0752% -87 - C6 -3MFL - PCXA_PSEPU -
141 PsiBlast_CBE 81.7252% -87 - C6 -3LKT 3.1 PCXA_PSEPU