@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VQQ3: (2017-11-28 )
MNALTQELVELLTLEKLEENIYRGISRNLVGKRVFGGQVLGQALRAASYTTDRPAHSLHAYFLYGGDINAPIIYEVDRLRDGKSFVSRQVRAIQHGRVIFSAMVSFANPEEGLNYQHPEPDYPAPEALKSESELKEGILNFVPENVRASFMRERHVEIRPIDPVNPFQPQPEAPFNAHYIRTHDRIPKQLEDISLHQAIVAFYSDFTLMTTALRPHGLSYISPSLQCASIDHAIYFHRPLRADEWMLYDMEATVSAASRGLNFGRMWQNGQLVCSTVQEGLMRLREIETQ

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

COA_D_6(4R4U)
?
[Raw transfer]




16 HHSearch 86.3842% -27 - C6 -1C8U - TESB_ECOLI -
38 Fugue 85.1742% -18 - C6 -1C8U - TESB_ECOLI -
10 PsiBlast_CBE 83.3443% -22 - C6 -4R4U 3.4 ?
2 PsiBlast_PDB 83.2843% -20 - C6 -4R4U - ? -
11 PsiBlast_CBE 82.8443% -24 - C6 -4R4U - ? -
12 PsiBlast_CBE 82.7043% -23 - C6 -4R4U - ? -
13 PsiBlast_CBE 81.5542% -17 - C6 -1C8U - TESB_ECOLI -
1 PsiBlast_PDB 81.4443% -25 - C6 -4QFW - ? -
3 PsiBlast_PDB 81.3442% -17 - C6 -1C8U - TESB_ECOLI -
15 HHSearch 74.7230% -37 - C6 -3RD7 - ? -
18 HHSearch 74.7037% -22 - C6 -3U0A - ? -
14 HHSearch 72.5630% -38 - C6 -3RD7 - ? -
4 PsiBlast_PDB 70.8331% -27 - C6 -3RD7 - ? -
20 HHSearch 70.4829% -15 - C6 -4R9Z - ? -
19 HHSearch 67.3929% -18 - C6 -4R9Z - ? -
6 PsiBlast_PDB 61.1821% -42 - C6 -3CJY - ? -
5 PsiBlast_PDB 60.7531% -6 - C6 -4R9Z - ? -
23 HHSearch 57.5321% -14 - C6 -3CJY - ? -
7 PsiBlast_PDB 52.9324% -94 - C6 -3BBJ - ? -
21 HHSearch 51.3218% -20 - C6 -3RQB - ? -