@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VRN7: (2017-12-04 )
MKANQEFLRQAIELAYNNIEKGGRPFGAVIVKDGKVIASGVNQILTTNDPTAHAELLAIRAASQVLGTANLEGCSVFASGHPCPMCMAAMRLAGIKTVNYAYSNEDGAPFGLSTAEIYADLVKPFAEQSMKIEYVPVRFEDRTDLYVFWKNYQAKQSGLK

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

IMD_B_6(1WKQ)
GUAD_BACSU
[Raw transfer]




IMD_A_5(1WKQ)
GUAD_BACSU
[Raw transfer]




HEZ_D_21(5JFY)
?
[Raw transfer]




GOL_C_15(5JFY)
?
[Raw transfer]




GOL_C_15(5JFY)
?
[Raw transfer]




GOL_C_17(5JFY)
?
[Raw transfer]




77 HHSearch 78.0633%-129 - C4 -1WWR - TADA_AQUAE -
4 PsiBlast_PDB 77.4238%-132 - C4 -1WWR - TADA_AQUAE -
76 HHSearch 76.9333%-125 - C4 -1WWR - TADA_AQUAE -
1 PsiBlast_PDB 74.9641% -37 - C4 -1WKQ - GUAD_BACSU -
2 PsiBlast_PDB 74.8640% -46 - C4 -1TIY - GUAD_BACSU -
73 HHSearch 74.6132%-120 - C4 -2B3J - TADA_STAAM -
69 HHSearch 74.0241% -34 - C4 -1WKQ 4.2 GUAD_BACSU
21 PsiBlast_CBE 73.0541% -35 - C4 -1WKQ 4.2 GUAD_BACSU
72 HHSearch 71.4332%-115 - C4 -2B3J - TADA_STAAM -
30 PsiBlast_CBE 69.9840%-134 - C4 -2B3J - TADA_STAAM -
6 PsiBlast_PDB 69.8937%-131 - C4 -2A8N - TADA_AGRFC -
29 PsiBlast_CBE 68.9740%-128 - C4 -2B3J - TADA_STAAM -
5 PsiBlast_PDB 68.7340%-132 - C4 -2B3J - TADA_STAAM -
7 PsiBlast_PDB 68.6736%-125 - C4 -2NX8 - TADA_STRP6 -
31 PsiBlast_CBE 68.6440%-133 - C4 -2B3J - TADA_STAAM -
24 PsiBlast_CBE 68.5042% -80 - C4 -5JFY 2.9 ?
3 PsiBlast_PDB 68.4342% -74 - C4 -5JFY 2.6 ?
84 HHSearch 68.1342% -80 - C4 -5JFY 2.9 ?
68 HHSearch 67.7823%-120 * C4 *1Z3A - TADA_ECOLI -
79 HHSearch 67.4428%-113 - C4 -2A8N - TADA_AGRFC -
23 PsiBlast_CBE 67.1342% -67 - C4 -5JFY 2.5 ?