@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VS18: (2017-12-05 )
MAHLVLASSSPRRRELLQQLGLNFEIYSPDIDESVHEGELVHQYVERLAREKAQAVLNIFPDSVIIAADTSLGLDGQIIGKPDSKQHAFDIWKQLSGRWHDVFSGICIATQQHILSQVVQTQVEFASLTTQDMEDYWATGEPVGKAGAYAIQGIASQYIPKIQGSYSNVVGLPLYEFSQLFKRVKT

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_A_8(4OO0)
?
[Raw transfer]




EDO_A_8(4OO0)
?
[Raw transfer]




EDO_B_13(4OO0)
?
[Raw transfer]




EDO_B_13(4OO0)
?
[Raw transfer]




30 HHSearch 91.2736%-115 - C5 -1EX2 - MAF_BACSU -
33 HHSearch 88.1544% -64 - C5 -4P0U - ? -
2 PsiBlast_PDB 85.5945% -72 - C5 -4P0E - YHDE_ECOLI -
32 HHSearch 85.3644% -58 - C5 -4P0E - YHDE_ECOLI -
1 PsiBlast_PDB 85.0945% -71 - C5 -4P0U - ? -
4 PsiBlast_PDB 83.3939%-106 - C5 -1EX2 - MAF_BACSU -
31 HHSearch 83.1232% -64 - C5 -4JHC - YCEF_ECOLI -
16 PsiBlast_CBE 82.9339%-104 - C5 -1EXC - MAF_BACSU -
5 PsiBlast_PDB 82.5939%-103 - C5 -1EXC - MAF_BACSU -
20 PsiBlast_CBE 82.1433% -75 - C5 -4JHC - YCEF_ECOLI -
7 PsiBlast_PDB 82.0533% -59 - C5 -4JHC - YCEF_ECOLI -
36 HHSearch 81.3240% -16 - C5 -4OO0 3.8 ?
8 PsiBlast_PDB 81.0432% -65 - C5 -4LU1 - ? -
37 HHSearch 80.2140% -13 - C5 -4OO0 2.3 ?
3 PsiBlast_PDB 76.3438% -12 - C5 -4OO0 2.3 ?
21 Fugue 76.0936% 4 - C5 -1EX2 - MAF_BACSU -
15 PsiBlast_CBE 75.9338% -15 - C5 -4OO0 3.8 ?
34 HHSearch 73.2235% 10 * C5 *2P5X - ASML_HUMAN -
6 PsiBlast_PDB 70.7035% 24 - C5 -2P5X - ASML_HUMAN -
35 HHSearch 61.2822% -0 - C5 -2AMH - ? -