@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VSA3: (2017-12-06 )
MKIRILTIGQKMPAWVLTGFEDYFKRIQPFVQTQVIKLPMAKRGKNDSEADILKYCQIEGESILNALKPNETLIALEVGGRELSTEKLADTMKQWMLEGNDVALAIGGPDGLSDQVRKAAAWHWSLSKLTMPHPLVRILLIEQLYRAMSINHNHPYHRA

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SFG_D_6(5TWK)
?
[Raw transfer]




SFG_B_8(5TWK)
?
[Raw transfer]




21 PsiBlast_CBE 95.6946%-127 - C2 -5TWK 6.8 ?
20 PsiBlast_CBE 95.5546%-118 - C2 -5TWK 6.5 ?
2 PsiBlast_PDB 95.0246%-128 - C2 -5TWK - ? -
22 PsiBlast_CBE 94.5446%-130 - C2 -5TWK - ? -
1 PsiBlast_PDB 93.6046%-126 - C2 -5TWJ - ? -
7 PsiBlast_PDB 87.2429%-159 - C- -1O6D - RLMH_THEMA -
36 HHSearch 86.8737% -82 - C2 -4FAK - RLMH_STAAU -
5 PsiBlast_PDB 86.8737% -82 - C2 -4FAK - RLMH_STAAU -
6 PsiBlast_PDB 86.6536% -80 - C2 -1VH0 - RLMH_STAAU -
37 HHSearch 85.0030%-152 - C- -1O6D - RLMH_THEMA -
4 PsiBlast_PDB 70.5539% -94 - C2 -1TO0 - RLMH_BACSU -
34 HHSearch 68.2847% - - C2 -1NS5 - RLMH_ECOLI -
33 HHSearch 66.9447% - - C2 -1NS5 - RLMH_ECOLI -
35 HHSearch 64.6340% -28 - C2 -1TO0 - RLMH_BACSU -
3 PsiBlast_PDB 62.4646% - - C2 -1NS5 - RLMH_ECOLI -
23 Fugue 59.1244% - - C2 -1NS5 - RLMH_ECOLI -
24 Fugue 46.0518% 4 - C- -3IC6 - ? -
18 PsiBlast_PDB 45.9423%-140 - C2 -3AFL - ? -
44 HHSearch 45.3720% -80 - C2 -4YQD - TRMD_HAEIN -
17 PsiBlast_PDB 45.0223%-143 - C2 -3A0O - ? -