@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VTC6: (2017-12-12 )
MSVHFLHTSDWHLGQFFYNHSRHYEHQQFLSWLLTQIQEKQPHALLIAGDIFDVINPGSQAQKQLYQFLADAHRIAPHMQTLMIAGNHDSGYRIEQVEPLLEKYNAKTVGVVRWNEDKTLDLDRLLLPIYNQNQDIVAWCLALPFLRSAEITGFNEHTTNSKNAIAYLHQQLIAEAKRRKTPDQALILMSHAHMQGGETSDSERPIIIGNEEALSTTLFEDAVDYVALGHLHKPQKVGQPHIRYSGSPIPLSFSEINYKHQVVEVKIDPSQDIDSRLQFEAVEIPRCIQLHRIRGELNEVLQQLKALPHGVIENIDHREYVDIEYYSLTPPQPNLRQQFEAALPPDRYRLVRISRQYVNKDTTNSNTTQHIALEPPTPEKLFQNIWEKQGYSADDAVLKDFLSLVQEAQKHLENDASH

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DA_A_11(1II7)
MRE11_PYRFU
[Raw transfer]




3 PsiBlast_PDB 99.0733% 0 - C- -4LU9 - ? -
2 PsiBlast_PDB 95.9533% 0 - C- -4M0V - ? -
23 PsiBlast_CBE 95.4633% -37 - C1 -4M0V - ? -
28 PsiBlast_CBE 95.3133% -40 - C1 -4LTY - ? -
1 PsiBlast_PDB 94.8733% -48 - C1 -4LTY - ? -
29 PsiBlast_CBE 94.0933% -35 - C1 -4LTY - ? -
22 PsiBlast_CBE 93.9733% -34 - C1 -4M0V - ? -
24 PsiBlast_CBE 93.8733% -33 - C1 -4LU9 - ? -
27 PsiBlast_CBE 93.5833% -36 - C1 -4LTY - ? -
25 PsiBlast_CBE 93.5733% -41 - C1 -4LU9 - ? -
26 PsiBlast_CBE 93.4133% -31 - C1 -4LU9 - ? -
21 PsiBlast_CBE 92.9933% -37 - C1 -4M0V - ? -
30 HHSearch 90.2931% -38 - C1 -4LTY - ? -
31 HHSearch 89.3631% -33 - C1 -4LTY - ? -
43 HHSearch 70.8819% -46 - C1 -4FBW - RAD32_SCHPO -
40 HHSearch 70.7317% -50 - C1 -3T1I - MRE11_HUMAN -
42 HHSearch 70.2219% -37 - C1 -4FBW - RAD32_SCHPO -
51 Fugue 67.8020% -17 - C1 -1II7 3.5 MRE11_PYRFU
41 HHSearch 67.7917% -35 - C1 -3T1I - MRE11_HUMAN -
33 HHSearch 67.6420% 32 - C1 -3THO - RAD50_THEMA -