@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VUD7: (2017-12-18 )
MAAWTPHVTVATVVEKDGRYLFVEEHSEGFVHTVFNQPAGHVECGETLTEAAIRETLEETGHHIDIDALLGIYTYTPPMFPDRTYYRFCFLAHVTHVESDPKLDTGIVSAVWMTLDELKESARARSPLVIKAIEDAMKGQHYPLALIYEHPFSPSLTSHLDA

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_A_4(2B0V)
?
[Raw transfer]




EDO_A_4(2B0V)
?
[Raw transfer]




EDO_A_4(2B0V)
?
[Raw transfer]




1 PsiBlast_PDB 92.3546% -79 - C1 -2B0V 3.0 ?
166 Fugue 91.4045% -80 - C1 -2B0V 3.0 ?
145 HHSearch 91.3946% -72 - C1 -2B0V 2.8 ?
2 PsiBlast_PDB 84.3437% -82 - C1 -3DKU - NUDJ_ECOK1 -
3 PsiBlast_PDB 83.9037% -87 - C1 -3SHD - NUDJ_ECOK1 -
4 PsiBlast_PDB 82.5637% -87 - C1 -4NFW - ? -
152 HHSearch 78.8035%-133 - C1 -4NFW - ? -
5 PsiBlast_PDB 78.4137% - - C1 -4NFX - ? -
153 HHSearch 76.1135% - - C1 -4NFX - ? -
146 HHSearch 66.7221%-114 - C1 -4HFQ - ? -
151 HHSearch 63.8727%-144 - C1 -3ID9 - ? -
160 HHSearch 58.4820%-129 - C1 -2RRK - NUDG_ECOLI -
170 Fugue 56.9715% -88 - C1 -3Q93 - 8ODP_HUMAN -
62 PsiBlast_CBE 56.2433%-110 - C1 -5IW5 - ? -
63 PsiBlast_CBE 55.5833%-105 - C1 -5IW4 - ? -
13 PsiBlast_PDB 55.3135% -58 - C2 -3X0I - ? -
61 PsiBlast_CBE 55.0333%-100 - C1 -5IW5 - ? -
12 PsiBlast_PDB 54.9535% -70 - C2 -1V8R - ? -
155 HHSearch 54.9119%-107 - C1 -5X1X - ? -
16 PsiBlast_PDB 54.9035% -69 - C2 -3X0L - ? -