@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VV07: (2017-12-21 )
MSHGMAGLPTATLIGQVELGRQVSIWFGAVVRADNCVVRIGNFSNIQENSVLHTDAGLELNIGEYVTVGHKVMLHGCTIGDNSLIGMNAVILNRAVIGKNCIIGANALIPEGKVIPDNSVVMGSPGKIVKTLDEEGAAKIRLSALHYAEHFKSYADLKEFYF

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PE5_A_9(4N27)
?
[Raw transfer]




PE5_D_14(4N27)
?
[Raw transfer]




PE5_A_8(4N27)
?
[Raw transfer]




PE5_A_8(4N27)
?
[Raw transfer]




1 PsiBlast_PDB 85.9252%-144 * C2 *4N27 2.9 ?
22 PsiBlast_CBE 85.6552%-148 - C2 -4N27 - ? -
21 PsiBlast_CBE 84.9952%-149 - C2 -4N27 - ? -
24 PsiBlast_CBE 84.9752%-149 - C2 -4N27 - ? -
25 PsiBlast_CBE 84.8852%-146 - C2 -4N27 4.2 ?
123 HHSearch 84.4950%-146 - C2 -4N27 4.2 ?
27 PsiBlast_CBE 83.2541%-138 - C2 -3VNP - ? -
23 PsiBlast_CBE 82.7352%-142 - C2 -4N27 2.4 ?
117 HHSearch 82.5739%-145 - C2 -1V3W - ? -
122 HHSearch 82.5343%-146 - C2 -4MFG - ? -
26 PsiBlast_CBE 82.3341%-135 - C2 -3VNP - ? -
119 HHSearch 81.5935%-147 - C2 -1XHD - ? -
2 PsiBlast_PDB 80.9841%-138 - C2 -3VNP - ? -
118 HHSearch 80.3039%-141 - C2 -1V67 - ? -
120 HHSearch 78.7739%-109 - C2 -3R3R - ? -
10 PsiBlast_PDB 76.7037%-147 - C2 -1XHD - ? -
6 PsiBlast_PDB 75.9646%-141 - C2 -4MFG - ? -
4 PsiBlast_PDB 75.3544%-148 - C2 -1V67 - ? -
3 PsiBlast_PDB 75.1444%-151 - C2 -1V3W - ? -
7 PsiBlast_PDB 75.0240% -58 - C2 -3TIO - YRDA_ECOLI -