@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VV23: (2017-12-21 )
MNDVRNDDPNFNVMGNFDHGLTLALSKGRILKETLPLLATAGINLLEDPEKSRKLIFPTTHKQVRILILRASDVPTYVENGAADLGVAGKDVLMEHGAQHVYELLDLQIAKCKLMTAGKVGMERPKGRLKIATKYVNLTRQYYASLGEQVDVIKLYGSMELAPLVGLGDYIVDVVDTGNTLRANGLEPLEEICKVSSRLIVNKASFKRKQVLLNPIISQLEQAVQSR

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PRT_G_7(1Q1K)
HIS1_ECOLI
[Raw transfer]




AMP_A_7(1H3D)
HIS1_ECOLI
[Raw transfer]




58 HHSearch 95.3846%-118 - C7 -2VD2 - HIS1_BACSU -
1 PsiBlast_PDB 92.3847%-123 - C7 -2VD2 - HIS1_BACSU -
61 HHSearch 90.6740%-151 - C7 -1VE4 - HIS1_THET2 -
27 PsiBlast_CBE 85.2633%-129 - C7 -1USY - HIS1_THEMA -
28 PsiBlast_CBE 84.9433%-136 - C7 -1USY - HIS1_THEMA -
4 PsiBlast_PDB 84.6533%-129 - C7 -1USY - HIS1_THEMA -
63 HHSearch 84.5635%-136 - C7 -1USY - HIS1_THEMA -
26 PsiBlast_CBE 84.0433%-130 - C7 -1USY - HIS1_THEMA -
60 HHSearch 82.7740% -52 * C7 *1Z7N - HIS1_LACLA -
5 PsiBlast_PDB 82.4333%-123 - C7 -1O64 - HIS1_THEMA -
62 HHSearch 82.1835%-127 - C- -1O63 - HIS1_THEMA -
7 PsiBlast_PDB 80.7333%-123 - C- -1O63 - HIS1_THEMA -
21 PsiBlast_CBE 77.7640% -20 - C7 -1Z7N - HIS1_LACLA -
3 PsiBlast_PDB 77.2040% -26 - C7 -1Z7N - HIS1_LACLA -
20 PsiBlast_CBE 76.8240% -23 - C7 -1Z7N - HIS1_LACLA -
22 PsiBlast_CBE 76.4240% -20 - C7 -1Z7N - HIS1_LACLA -
2 PsiBlast_PDB 74.7039% -22 - C7 -1VE4 - HIS1_THET2 -
30 PsiBlast_CBE 72.3835% -17 - C7 -2VD3 - HIS1_METTH -
6 PsiBlast_PDB 72.2535% -17 - C7 -2VD3 - HIS1_METTH -
38 PsiBlast_CBE 70.2032% 24 - C7 -4YB7 - HIS1_CAMJR -